DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rsph1

DIOPT Version :10

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_079566.1 Gene:Rsph1 / 22092 MGIID:1194909 Length:301 Species:Mus musculus


Alignment Length:293 Identity:66/293 - (22%)
Similarity:107/293 - (36%) Gaps:52/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   750 GVLHGNCYLEYPDGSVYCGELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPES 814
            |..||:.....|:|..|.|..:.|...|.|.........|.|::...:.||.|.:..     |:.
Mouse    28 GERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIY-----PDG 87

  Fly   815 EVYEGNFCEGLFHGHGVMRN-NRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSC 878
            ..|||.:.:...||.||... |...|.||:..:.|.|.|......:|.||:|.:...::.|....
Mouse    88 SRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAEL 152

  Fly   879 ITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEGELTLLGPNGRGEYYMPSGDACGGSGAMGTGEF 943
            | :....::|.|...:..|.|..||:           :|....|||.:...:         .||.
Mouse   153 I-HLNHRYQGKFMNKNPVGPGKYVFD-----------IGCEQHGEYRLTDTE---------RGEE 196

  Fly   944 DDTCELIGNKMFGQLSGTWDTVRIQAGEL---VLNRRFPKYPSSLGRQ-------VVDHNRKWRS 998
            ::..|.:.|     :...|..:.|....|   .|:...|. |...|::       |.|.:...::
Mouse   197 EEEEETLVN-----IVPKWKALNITELALWTPTLSEEQPP-PEGQGQEEPQGLTGVGDPSEDIQA 255

  Fly   999 LFNNFESDLANCTASTSSSGGNQSAGTLRKSSK 1031
              ..||.:|       ...|.::...|.|:.|:
Mouse   256 --EGFEGEL-------EPRGADEDVDTFRQESQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 ATS1 <238..>367 CDD:444065
PH-like 616..715 CDD:473070
COG4642 <745..890 CDD:443680 37/140 (26%)
PLN03185 835..>962 CDD:215619 27/126 (21%)
VPS9 1373..1479 CDD:460489
Rsph1NP_079566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 4/12 (33%)
COG4642 <15..165 CDD:443680 38/142 (27%)
MORN 1 20..43 5/14 (36%)
MORN 2 44..66 5/21 (24%)
MORN 3 67..89 6/26 (23%)
MORN 4 90..112 8/21 (38%)
MORN 5 113..135 6/21 (29%)
MORN 6 159..181 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..301 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.