DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and K11D2.1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001368497.1 Gene:K11D2.1 / 187290 WormBaseID:WBGene00010768 Length:278 Species:Caenorhabditis elegans


Alignment Length:248 Identity:64/248 - (25%)
Similarity:99/248 - (39%) Gaps:64/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 HMRLYEEGKEL----LDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERASVKS------ 230
            ||.:..:.::|    ||...||..|:      :|..|...|.||:::|....||:...|      
 Worm    50 HMAILMKHEKLAVRRLDDFEGNLTFL------DLHTDLDVLLVATSREIYAVERSGTSSEIVKIL 108

  Fly   231 -ISSGHSER-----------------SVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIR 277
             .|.|.|.:                 ..||....|:.:...   ..||:.|....|.||.| .||
 Worm   109 VDSVGISPKKNNLANKIQFPWPVRIVEAAAGHDFLIFRDTT---GNLFSMGTGTRGELGVG-LIR 169

  Fly   278 RAN-VMRLQKLDSMGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQLGEDVSSPMEITITENTAAL 341
            |.: .:.:::|..:.:..:|.|..||||.|..|..|.||.|.:.|||:|..|         |...
 Worm   170 RVDEPVHIEQLVGIRIKKVACGGWHTVALTEGGDAYTWGWNRYGQLGKDKGS---------TEVY 225

  Fly   342 PI----------EQNSALEATCGDYHTLLLNASGQ---IHSLQPAPPMR--HL 379
            |:          |:| .|:..|.:::|.::..:|.   :....|.||:.  ||
 Worm   226 PVLIDPEEEKFGEEN-ILDVACTEHNTQIVIKTGHAPFVLGTNPTPPINEFHL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 15/46 (33%)
RCC1_2 292..321 CDD:290274 12/28 (43%)
RCC1 308..361 CDD:278826 17/62 (27%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
K11D2.1NP_001368497.1 ATS1 <118..>259 CDD:227511 38/154 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.