DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and ran-3

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_495753.1 Gene:ran-3 / 174332 WormBaseID:WBGene00004304 Length:569 Species:Caenorhabditis elegans


Alignment Length:330 Identity:77/330 - (23%)
Similarity:124/330 - (37%) Gaps:99/330 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 GSGRDVGHP-----------HAWQTLGFDPLELHAEGVRIRRVCCSAQGVVFVGASGETYVM--- 161
            |.|..:|||           ..::..|..||:..|.||  .....:::|.|::....|...:   
 Worm   158 GEGEALGHPGRTTTKKPRKVDIFEEEGLKPLQAVAGGV--HSAVLTSEGEVYMCGINEKGTVPAE 220

  Fly   162 -----GSCGEVFKAEQQPRHMRLYEEGKELLDLAAGNEHFVML------VAPYNLADDALQLSV- 214
                 ||..|..|.:.:.   .:.:||| ::.||||......|      :|..||.:....:.| 
 Worm   221 GVEKEGSTDEFAKVKFEE---DIEKEGK-IVMLAAGASFTAALTDQGSVIAWGNLRNSNGNVDVH 281

  Fly   215 ---ASAKEEP-----EDERASVKSISSGHSERSVAANTRHLLHQGYALLHTQ--LFTFGASNNGL 269
               ...:|.|     :.:|..||          :||...||:     :|..:  |.|||....|.
 Worm   282 PLLHKMQEAPVVIVHQAKRKIVK----------IAAGENHLV-----MLDEKGCLLTFGDGEMGQ 331

  Fly   270 LG----------------SGDHIRRANVMRLQK----LDSMGVCSIAAGLEHTVARTLDGRLYHW 314
            ||                ||||:  ...:|.:.    .|.:.....|:|. .|:....||:.|.:
 Worm   332 LGRSSRTKTIRSKYMCDESGDHL--LVPLRFKHKGKFFDVVAKNVFASGF-WTIVHGEDGKYYAF 393

  Fly   315 GLNNHSQL---------GEDVSSPMEITITENTAALPIEQNS-ALEATC----GDYHTLLLNASG 365
            ||||::||         |:|.....|:.:     .||.|..: ..|.|.    |..|.::|.:.|
 Worm   394 GLNNYAQLGIKVDEADVGQDGQDNRELRV-----FLPAEAPAFGAERTFVNIEGVQHVVILGSDG 453

  Fly   366 QIHSL 370
            ::.::
 Worm   454 KVFAM 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 16/67 (24%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 19/66 (29%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
ran-3NP_495753.1 ATS1 163..569 CDD:227511 75/325 (23%)
RCC1_2 189..215 CDD:290274 6/27 (22%)
RCC1_2 246..276 CDD:290274 8/29 (28%)
RCC1_2 302..331 CDD:290274 11/43 (26%)
RCC1 510..565 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.