DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Als2 and Rcc1

DIOPT Version :9

Sequence 1:NP_649347.1 Gene:Als2 / 40410 FlyBaseID:FBgn0037116 Length:1486 Species:Drosophila melanogaster
Sequence 2:NP_001184011.1 Gene:Rcc1 / 100088 MGIID:1913989 Length:434 Species:Mus musculus


Alignment Length:161 Identity:42/161 - (26%)
Similarity:68/161 - (42%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 VASAKEEPEDERASVKSISSGHSERSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHI-- 276
            :|..:..|||.....|.:....: |..|..:..:.|:.:......:.|.|..:.|.||.|:.:  
Mouse     6 IAKRRSPPEDAIPKSKKVKDTRN-RGPATRSCQVSHRSHNTEPGLVLTLGQGDVGQLGLGESVLE 69

  Fly   277 --RRANVMRLQKLDSMGVCSIAAGLEHTVARTLDGRLYHWGLNNHSQLGEDVSSPMEITITENTA 339
              :.|.|..||     .|....||..|||..:..|::|.:|.|:...||.|.|       .|.:.
Mouse    70 RKKPALVPLLQ-----DVVQAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTS-------VEGSE 122

  Fly   340 ALP--IE-QNSALEATCGDYHTLLLNASGQI 367
            .:|  :| |...::.:.||.||..|...|::
Mouse   123 MVPGKVELQEKVVQVSAGDSHTAALTEDGRV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Als2NP_649347.1 RCC1 258..304 CDD:278826 15/49 (31%)
RCC1_2 292..321 CDD:290274 10/28 (36%)
RCC1 308..361 CDD:278826 16/55 (29%)
PH-like 616..715 CDD:302622
VPS9 1373..1479 CDD:280383
Rcc1NP_001184011.1 RCC1 48..95 CDD:278826 16/51 (31%)
RCC1 98..147 CDD:278826 16/55 (29%)
RCC1 150..200 CDD:278826 1/4 (25%)
RCC1_2 187..216 CDD:290274
RCC1 203..268 CDD:278826
RCC1 271..322 CDD:278826
RCC1 325..368 CDD:278826
RCC1 376..427 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.