DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11249 and PKp3

DIOPT Version :9

Sequence 1:NP_649346.1 Gene:CG11249 / 40409 FlyBaseID:FBgn0037115 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_564402.1 Gene:PKp3 / 840138 AraportID:AT1G32440 Length:571 Species:Arabidopsis thaliana


Alignment Length:455 Identity:88/455 - (19%)
Similarity:158/455 - (34%) Gaps:125/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GTQHDNQSLIVKLREAEISVSK-ELGFPVTSSVMVKISPRHQFTGGF-----STQFRQEGKKC-- 225
            |....::.:|.||.||.::|:: .:.....:|..:.|....::...|     :.....:|.:.  
plant   108 GPSSSSREMIWKLAEAGMNVARLNMSHGDHASHQITIDLVKEYNSLFVDKAIAIMLDTKGPEVRS 172

  Fly   226 ------VELVQGQKVILTVDRQYSDRSNADVIYVNARFLIVDVHPLDFILI-GEDIQLMVRSIHA 283
                  :.|.:||:...|:.|..|.:   |.:.||....:.||...|.:|: |..:.|.|:|..:
plant   173 GDVPQPIFLEEGQEFNFTIKRGVSLK---DTVSVNYDDFVNDVEVGDILLVDGGMMSLAVKSKTS 234

  Fly   284 DHLKGCVARGGMLYA--HMPV-----LFPARCRRFRISYEELEDLTFAREVGLNVVVSHIVGTPK 341
            |.:|..|..||.|.:  |:.|     ..|:      |:.::.||:.|..:..::......|...|
plant   235 DLVKCVVIDGGELQSRRHLNVRGKSATLPS------ITDKDWEDIKFGVDNQVDFYAVSFVKDAK 293

  Fly   342 YVDNLEHAMSAMHCDGMRLYARVVLNEVQGCKGELNWAIKRYDGFLVELAEP-ATVPDIMHLCPD 405
            .|..|:                   |.::.|..:::..:|      :|.|:. ..:|.|:..| |
plant   294 VVHELK-------------------NYLKTCSADISVIVK------IESADSIKNLPSIISAC-D 332

  Fly   406 AECFMQLTYAAKKPIIFDPRLLDEQKLRVDPAHYYYTFYYPDKYVTTCPQPKGTIYFRLLQSAIF 470
            .....:....|:.||...|.|.:|...|....|                  |..|....:..::.
plant   333 GAMVARGDLGAELPIEEVPLLQEEIIRRCRSIH------------------KPVIVATNMLESMI 379

  Fly   471 EQISPTALANTPYCDRSHTGADSLARSVVTA-------SIEV-HAVA------------------ 509
            ...:||....:........|||::..|..||       ::.| |.||                  
plant   380 NHPTPTRAEVSDIAIAVREGADAIMLSGETAHGKFPLKAVNVMHTVALRTEASLPVRTSASRTTA 444

  Fly   510 -----------------------IVVIGVTTRMVQKISHFRPHAPILFVSHMRSAEDYVSIYHNV 551
                                   ::|...|..|...:||:||.|.|...::.|.....:::|..|
plant   445 YKGHMGQMFAFHASIMANTLSSPLIVFTRTGSMAVLLSHYRPSATIFAFTNQRRIMQRLALYQGV 509

  Fly   552  551
            plant   510  509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11249NP_649346.1 Pyruvate_Kinase 158..>332 CDD:304951 41/184 (22%)
PK_C 492..594 CDD:280960 20/109 (18%)
PKp3NP_564402.1 PLN02623 3..569 CDD:215334 88/455 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.