DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11249 and AT3G55810

DIOPT Version :9

Sequence 1:NP_649346.1 Gene:CG11249 / 40409 FlyBaseID:FBgn0037115 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_191140.1 Gene:AT3G55810 / 824747 AraportID:AT3G55810 Length:492 Species:Arabidopsis thaliana


Alignment Length:480 Identity:99/480 - (20%)
Similarity:174/480 - (36%) Gaps:160/480 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 TQFRQEGKKCVELVQGQKVILTVDRQYSDRSNADVIYVNARFLIVDVHPLDFILIGE-DIQLMVR 279
            |.|.:|||. ::|.|||::.:::|  |....::::|.::.:.|..||.|.|.||..: .|.|.|.
plant    70 TGFLKEGKP-IQLNQGQEITISID--YKIEGDSNIISMSYKKLAEDVKPGDVILCSDGTISLTVL 131

  Fly   280 SIHADHLKGCVARGGMLYAHMPVLFPARCRRFRISYEELEDLTFAREVGLNVVVSHIV------- 337
            |        |....|::          |||        .|:.|...| ..||.:..||       
plant   132 S--------CDKSFGLV----------RCR--------CENSTILGE-RKNVNLPGIVVDLPTLT 169

  Fly   338 ----------GTPKYVDNL-------------------EHAMSAMHCDGMRLYARVVLNEVQGCK 373
                      |.|..:|.:                   ||:.:.|           ::::|:..:
plant   170 EKDKEDIIQWGVPNKIDIIALSFVRKGSDLTEVRKLLGEHSKNIM-----------LMSKVENQE 223

  Fly   374 GELNW--AIKRYDGFLVELAEPATVPDIMHLCPDAECFMQLTYAAKKPIIFDPRLLDEQKLRVDP 436
            |.:|.  .::..|.|:|...:......|..:....:..:::..|..||::...::|:...:...|
plant   224 GVMNCEKILENSDAFMVARGDLGMEIQIEKMFLAQKTMIKMANALGKPVVTATQMLESMTVSPRP 288

  Fly   437 AHYYYTFY---------------------YPDKYVTT----CPQPKGTIYFRLLQSAIFEQISPT 476
            .....|..                     :|:..|.|    |.:.:..|.:.:|.......:|  
plant   289 TRAEATDVANAVLDGTDCVMLSGETAAGAHPEAAVLTMSRICKEAEDFIDYDILHKKTLGMLS-- 351

  Fly   477 ALANTPYCDRSHTGADSLARSVVTASIEVHAVAIVVI---GVTTRMVQKISHFRPHAPILFVSHM 538
             |..:|        .:|||.|||:.:..|.|.||||:   |.|..:|.|   :||..|||.|...
plant   352 -LPLSP--------IESLAASVVSTAQSVFASAIVVLTKGGYTAELVAK---YRPSVPILSVIVP 404

  Fly   539 RSAEDYVSIYHNVTMLPFRTKC--IIAH--RRNVFLKAI-----------------------YAL 576
            ..|:.     :::.|     .|  .:||  ||.:..:.|                       .|:
plant   405 EIAQG-----NDIEM-----SCSDSVAHVARRGLIYRGIIPVVATGSSARDSNKDATEEMINLAI 459

  Fly   577 AYLVKRKIAKQNDQVILVYNYEDGT 601
            .:...:.|.|..|.::.::.. ||:
plant   460 GFAKTKGICKNGDSIVALHKI-DGS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11249NP_649346.1 Pyruvate_Kinase 158..>332 CDD:304951 32/116 (28%)
PK_C 492..594 CDD:280960 34/131 (26%)
AT3G55810NP_191140.1 PLN02461 1..492 CDD:215255 99/480 (21%)
Pyruvate_Kinase 17..491 CDD:304951 99/480 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.