DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11249 and AT3G55650

DIOPT Version :9

Sequence 1:NP_649346.1 Gene:CG11249 / 40409 FlyBaseID:FBgn0037115 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_191124.1 Gene:AT3G55650 / 824731 AraportID:AT3G55650 Length:510 Species:Arabidopsis thaliana


Alignment Length:538 Identity:110/538 - (20%)
Similarity:189/538 - (35%) Gaps:157/538 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IKHHLLGGVRCFMVNLFEGTQHDNQSLIVKLREAEISVSKELGFPVTSSVMVKISPRHQFTGGFS 215
            |:..|..|:.....|...|:...:|..:..||.|..:..      :.|:||:........||   
plant    34 IEKLLKAGMNVARFNFSHGSHSYHQETLDNLRTAMDNTG------ILSAVMLDTKGPEIRTG--- 89

  Fly   216 TQFRQEGKKCVELVQGQKVILTVDRQYSDRSNADVIYVNARFLIVDVHPLDFILIGE-DIQLMVR 279
              |.:|||. ::|.|||::.:::|  |....:::||.::.:.|..||.|.|.||..: .|.|.|.
plant    90 --FLKEGKP-IQLNQGQEITISID--YMIEGDSNVISMSYKKLAEDVKPGDVILCSDGTISLTVL 149

  Fly   280 SIHADHLKGCVARGGMLYAHMPVLFPARCRRFRISYEE--------LEDLTFAREVGLNVVVSHI 336
            |        |....|        |...||....|..|.        :.||....|.....::.. 
plant   150 S--------CDKSFG--------LVRCRCENSAILGERKNVNLPGIVVDLPTLTEKDKEDIIQW- 197

  Fly   337 VGTPKYVDNL-------------------EHAMSAMHCDGMRLYARVVLNEVQGCKGELNW--AI 380
             |.|..:|.:                   ||:.:.|           ::::|:..:|.:|.  .:
plant   198 -GVPNKIDIIALSFVRKGSDLTEVRRLLGEHSKNIM-----------LMSKVENQEGVMNCEKIL 250

  Fly   381 KRYDGFLVELAEPATVPDIMHLCPDAECFMQLTYAAKKPIIFDPRLLDEQKLRVDPAHYYYTFY- 444
            :..|.|:|...:......|..:....:..:::..|..||::...::|:...:...|.....|.. 
plant   251 ENSDAFMVARGDLGMEIPIEKMFLAQKTMIKMANALGKPVVTATQMLESMTVSPRPTRAEATDVA 315

  Fly   445 --------------------YPDKYVTT----CPQPKGTIYFRLLQSAIFEQISPTALANTPYCD 485
                                :|:..|.|    |.:.:..|.:.:|.......:|   |..:|   
plant   316 NAVLDGTDCVMLSGETAAGAHPEAAVLTMSRICKEAEDFIDYDILHKKTLGMVS---LPLSP--- 374

  Fly   486 RSHTGADSLARSVVTASIEVHAVAIVVI---GVTTRMVQKISHFRPHAPIL--FVSHMRSAEDYV 545
                 .:|||.|||:.:..|.|.||||:   |.|..:|.|   :||..|||  .|..:....|  
plant   375 -----IESLAASVVSTAQSVFASAIVVLTKGGYTAELVAK---YRPSVPILSVIVPEIAQGND-- 429

  Fly   546 SIYHNVTMLPFRTKC--IIAH--RRNVFLKAI-----------------------YALAYLVKRK 583
                      ....|  .:||  ||.:..:.|                       .|:.:...:.
plant   430 ----------MEMSCSDSVAHAARRGLIYRRIIPVVATGSSARDSNKDATEEMINLAIGFAKTKG 484

  Fly   584 IAKQNDQVILVYNYEDGT 601
            |.|..|.::.::.. ||:
plant   485 ICKNGDSIVALHKI-DGS 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11249NP_649346.1 Pyruvate_Kinase 158..>332 CDD:304951 45/182 (25%)
PK_C 492..594 CDD:280960 33/133 (25%)
AT3G55650NP_191124.1 PLN02461 1..510 CDD:215255 110/538 (20%)
Pyruvate_Kinase 17..509 CDD:304951 110/538 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.