DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11249 and CG7362

DIOPT Version :9

Sequence 1:NP_649346.1 Gene:CG11249 / 40409 FlyBaseID:FBgn0037115 Length:642 Species:Drosophila melanogaster
Sequence 2:NP_650388.2 Gene:CG7362 / 41787 FlyBaseID:FBgn0038258 Length:793 Species:Drosophila melanogaster


Alignment Length:341 Identity:62/341 - (18%)
Similarity:122/341 - (35%) Gaps:99/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 ISYEELEDLTFAREVGLNVVVSHIVGTPKYVDNLEHAMSAMHC---DGMRLYARVVLNEVQGCKG 374
            |:.::..||.|..:..::::.:..:...|.:..:..|:.|  |   :.:::.:::   |.|....
  Fly   121 ITEQDKLDLKFGADQKVDMIFASFIRDAKALKEIRQALGA--CPSSEHIKIISKI---ESQQALA 180

  Fly   375 ELNWAIKRYDGFLVELAEPATVPDIMHLCPDAECFMQLTYAAK-----KPIIFDPRLLDEQKLRV 434
            .::..|:..||.:|.|.....     .:..:|....|.:..||     ||:|...::::....:.
  Fly   181 NIDEIIRESDGIMVALGNMGN-----EIALEAVPLAQKSIVAKCNKVGKPVICANQMMNSMITKP 240

  Fly   435 DPAHYYYTFY---------------------YPDKYV----TTCPQPKGTIYFRLLQSAIFEQIS 474
            .|.....:..                     ||.:.|    ..|.:.:..:::..:|:.:..::.
  Fly   241 RPTRAESSDVANAILDGCDALVLSDETAKGKYPVQCVQCMARICAKVESVLWYESIQNNLKSEVR 305

  Fly   475 PTALANTPYCDRSHTGADSLARSVVTASIEVHAVAIVVIGVTTRMVQKISHFRPHAPILFVSHMR 539
            ..|        ..|..|.|.|  :..|:....|.||||....:.:.|.:|..||..||:.:    
  Fly   306 INA--------ADHISAVSTA--IAEAATVSQAQAIVVASPCSIVSQMVSQMRPPCPIVLL---- 356

  Fly   540 SAEDYVSIYHNVTMLPFRTKCIIAHRRNVFLKAIYALAYLVKRKIAKQNDQVILVY---NY---- 597
                              |.|.....:::..:.:|.|  |||.          :||   ||    
  Fly   357 ------------------TGCPHEAAQSLLFRGVYPL--LVKE----------MVYGSVNYCRIM 391

  Fly   598 EDGTKFPEKYIVYKLD 613
            :.|.|     |:.|||
  Fly   392 QSGLK-----ILAKLD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11249NP_649346.1 Pyruvate_Kinase 158..>332 CDD:304951 4/18 (22%)
PK_C 492..594 CDD:280960 21/101 (21%)
CG7362NP_650388.2 Pyruvate_Kinase 35..407 CDD:304951 62/341 (18%)
pyruv_kin 35..391 CDD:273424 56/323 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.