DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11249 and Pklr

DIOPT Version :9

Sequence 1:NP_649346.1 Gene:CG11249 / 40409 FlyBaseID:FBgn0037115 Length:642 Species:Drosophila melanogaster
Sequence 2:XP_006501198.1 Gene:Pklr / 18770 MGIID:97604 Length:598 Species:Mus musculus


Alignment Length:499 Identity:106/499 - (21%)
Similarity:199/499 - (39%) Gaps:84/499 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 IKHHLLGGVRCFMVNLFEGTQHDNQSLIVKLRE-AEISVSKELGF-PVTSSVMVKISPRHQFTGG 213
            :|..:..|:....:|...|:...:...|..:|| ||...:..|.: ||..::..| .|.      
Mouse   128 LKEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTK-GPE------ 185

  Fly   214 FSTQFRQEGKKC-VELVQGQKVILTVDRQYSDRSNADVIYVNARFLIVDVHPL-DFILIG----- 271
            ..|...|.|.:. ||:|:|.:|::|||.::..|.:|..::       ||.|.: ..:.:|     
Mouse   186 IRTGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVW-------VDYHNITQVVAVGGRIYI 243

  Fly   272 ED--IQLMVRSIHADHLKGCVARGGMLYAHMPVLFP-ARCRRFRISYEELEDLTFAREVGLNVVV 333
            :|  |.|:||.|..:.|...|..||.|.....|..| |......:|.::|.||.|..|..::::.
Mouse   244 DDGLISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVDIIF 308

  Fly   334 SHIVGTPKYVDNLEHAMSAMHCDGMRLYARVVLNEVQGCKGELNWAIKRYDGFLVELAEPATVP- 397
            :..|   :...::.....|:..:|..:   .::::::..:|     :|::|..| |:::...|. 
Mouse   309 ASFV---RKASDVVAVRDALGPEGRGI---KIISKIENHEG-----VKKFDEIL-EVSDGIMVAR 361

  Fly   398 -DIMHLCPDAECFMQLTY------AAKKPIIFDPRLLDEQKLRVDPAHYYYTFY----------- 444
             |:....|..:.|:....      .|.||::...::|:....:..|.....:..           
Mouse   362 GDLGIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGADCI 426

  Fly   445 ----------YPDKYV----TTCPQPKGTIYFRLLQSAIFEQISPTA-LANTPYCDRSHTGADSL 494
                      :|.:.|    ....:.:..:|.|.|    ||::...| |:..|        .:..
Mouse   427 MLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQL----FEELRRAAPLSRDP--------TEVT 479

  Fly   495 ARSVVTASIEVHAVAIVVIGVTTRMVQKISHFRPHAPILFVSHMRSAEDYVSIYHNVTMLPFRTK 559
            |...|.||.:..|.||:|:..|.|..|.:|.:||.|.::.|:....|...|.:...|..|.:|..
Mouse   480 AIGAVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLYREP 544

  Fly   560 CIIAHRRNVFLKAIYALAYLVKRKIAKQNDQVILVYNYEDGTKF 603
            .......:|..:..:.:.....|...:..|.||:|..:..|:.:
Mouse   545 PEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGY 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11249NP_649346.1 Pyruvate_Kinase 158..>332 CDD:304951 50/185 (27%)
PK_C 492..594 CDD:280960 26/101 (26%)
PklrXP_006501198.1 Pyruvate_Kinase 109..597 CDD:238178 106/499 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0469
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.