DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and Cpr65Az

DIOPT Version :9

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:106 Identity:34/106 - (32%)
Similarity:50/106 - (47%) Gaps:24/106 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTEN-EYLEISGSYSYFDANGQEVTVT 94
            |:..|||  :.:.||||.:.|...:|....|...::|.|.|. |.....||:||....|||:::|
  Fly   115 PIIKLES--KVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    95 YKADDHGFVPEGGAILPQISLAAKQVSEQVPQPDLDYAKPP 135
            |.||::||.|:|               :.:|.|      ||
  Fly   178 YIADENGFQPQG---------------DHLPTP------PP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 19/55 (35%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.