DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and Cpr65Az

DIOPT Version :10

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:106 Identity:34/106 - (32%)
Similarity:50/106 - (47%) Gaps:24/106 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PVAILESSHEKHEDGSYNFSYLGEDGTHRREEAVVRNQGTEN-EYLEISGSYSYFDANGQEVTVT 94
            |:..|||  :.:.||||.:.|...:|....|...::|.|.|. |.....||:||....|||:::|
  Fly   115 PIIKLES--KVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLT 177

  Fly    95 YKADDHGFVPEGGAILPQISLAAKQVSEQVPQPDLDYAKPP 135
            |.||::||.|:|               :.:|.|      ||
  Fly   178 YIADENGFQPQG---------------DHLPTP------PP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 19/55 (35%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 19/55 (35%)

Return to query results.
Submit another query.