DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and Lcp2

DIOPT Version :9

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_001260802.1 Gene:Lcp2 / 35818 FlyBaseID:FBgn0002533 Length:126 Species:Drosophila melanogaster


Alignment Length:137 Identity:32/137 - (23%)
Similarity:59/137 - (43%) Gaps:25/137 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKILIVALSLCTAVVLSAPV---DHVTSTTQPPVAILESSHEKHEDGSYNFSYLGEDGTHRREE 62
            |||.:::...:..|..| |||   |.|.:.      :|..|.:...|| ::.|....:|      
  Fly     1 MFKFVMILAVVGVATAL-APVSRSDDVHAD------VLSRSDDVRADG-FDSSLHTSNG------ 51

  Fly    63 AVVRNQGTENEYLEISGSYSYFDANGQEVTVTYKADDHGFVPEGGAI-----LPQ-ISLAAKQVS 121
              :....:.:.:..|.|::.:....|:.|.|.|.|:::|:.|.|..|     :|: |:.|...:.
  Fly    52 --IEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIARAVAWLE 114

  Fly   122 EQVPQPD 128
            ...|.|:
  Fly   115 SHPPAPE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:278791 9/54 (17%)
Lcp2NP_001260802.1 Chitin_bind_4 42..89 CDD:278791 9/54 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.