DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and CG15756

DIOPT Version :10

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_572895.1 Gene:CG15756 / 32308 FlyBaseID:FBgn0030493 Length:298 Species:Drosophila melanogaster


Alignment Length:87 Identity:27/87 - (31%)
Similarity:38/87 - (43%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QPPVAILES-SH------------EKHEDGSYNFSYLGEDGTHRREEAVVRNQGTENEYLEISGS 80
            ||||.:::. ||            ::..||.|.|.|..::|..|.|.|.....| ::..|...|.
  Fly    77 QPPVVVVQKPSHTETSPRLVDSFDQRSLDGQYEFRYQLDNGNTRYERAYWLPVG-KDLVLAKKGY 140

  Fly    81 YSYFDANGQEVTVTYKADDHGF 102
            ||....|.:..||.|.||..|:
  Fly   141 YSVPLPNDKYSTVFYTADHRGY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 18/54 (33%)
CG15756NP_572895.1 Chitin_bind_4 108..162 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.