DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78E and LOC1276152

DIOPT Version :10

Sequence 1:NP_649345.1 Gene:Cpr78E / 40408 FlyBaseID:FBgn0037114 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_315462.3 Gene:LOC1276152 / 1276152 VectorBaseID:AGAMI1_002743 Length:136 Species:Anopheles gambiae


Alignment Length:68 Identity:19/68 - (27%)
Similarity:27/68 - (39%) Gaps:20/68 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 CFNLPQE----------PILSEALKEP-IAFLGGMFAGLLRLDLN--------EEPL-KDWVTRT 93
            ||.:.||          .::....|.| |.|:........|:||.        :|.| ||.||.:
Mosquito    90 CFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVS 154

  Fly    94 VEA 96
            |:|
Mosquito   155 VDA 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78ENP_649345.1 Chitin_bind_4 47..102 CDD:459790 19/68 (28%)
LOC1276152XP_315462.3 Chitin_bind_4 38..85 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.