DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32444 and Mfng

DIOPT Version :9

Sequence 1:NP_730670.1 Gene:CG32444 / 40406 FlyBaseID:FBgn0043783 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_954541.1 Gene:Mfng / 315119 RGDID:735126 Length:321 Species:Rattus norvegicus


Alignment Length:235 Identity:48/235 - (20%)
Similarity:75/235 - (31%) Gaps:108/235 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PHGHEGYPGKLTC---LITYQLDNENRLWVRYEATTDRSTMVNLSSHAYFNLAGHGSG---AKGL 201
            |..|:.|.||.:.   :...:|.::|           |:.:|.      |..|..|:|   .:.|
  Rat   160 PQDHDVYVGKPSLNRPIHASELQSKN-----------RTRLVR------FWFATGGAGFCINRQL 207

  Fly   202 SEHTVEIAS-DQIVDTDELQIPTGKLVDVKDTVFDLRLPVLMRDRLMQFENRQIKGYDNC---FV 262
            :...|..|| ...|||..|                :|||                  |:|   ::
  Rat   208 ALKMVPWASGSHFVDTSAL----------------IRLP------------------DDCTVGYI 238

  Fly   263 VN---GGRVQKSVAKVAKIVHP--------PSCRVLEVWTDQPGMQFYTANNLTSIVGKNCTKYE 316
            :.   |||:|.|     .:.|.        .:.::||..|...|:          ..||      
  Rat   239 IECKLGGRLQPS-----PLFHSHLETLQLLGTAQLLEQVTLSYGV----------FEGK------ 282

  Fly   317 KHGSFCVETEKFPDAMNHPEFPSISLEPNEKYR--HDVLY 354
                  :...|.|...:|.|.||       ::|  |.:||
  Rat   283 ------LNIIKLPGPFSHEEDPS-------RFRSLHCLLY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32444NP_730670.1 galactose_mutarotase_like 26..356 CDD:185696 48/235 (20%)
MfngNP_954541.1 Fringe 51..300 CDD:190308 44/224 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.