DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32444 and Mfng

DIOPT Version :9

Sequence 1:NP_730670.1 Gene:CG32444 / 40406 FlyBaseID:FBgn0043783 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_032621.1 Gene:Mfng / 17305 MGIID:1095404 Length:321 Species:Mus musculus


Alignment Length:238 Identity:51/238 - (21%)
Similarity:77/238 - (32%) Gaps:87/238 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 FRHVSPHGHEGYPGKLTCLITYQLDNE--------NR-LWVRYEATTDRSTMVNLSSHAYFNLAG 193
            |.||....:......|..|.|:..|.:        || :......:.:|:.:|.      |..|.
Mouse   138 FCHVDDDNYVNPKALLQLLKTFPQDRDVYVGKPSLNRPIHASELQSKNRTKLVR------FWFAT 196

  Fly   194 HGSG---AKGLSEHTVEIAS-DQIVDTDELQIPTGKLVDVKDTVFDLRLPVLMRDRLMQFENRQI 254
            .|:|   .:.|:...|..|| ...|||..|                :|||               
Mouse   197 GGAGFCINRQLALKMVPWASGSHFVDTSAL----------------IRLP--------------- 230

  Fly   255 KGYDNC---FVVN---GGRVQKSVAKVAKIVHPPSCRVLEVWTDQPGMQFYTANNLTSIVGKNCT 313
               |:|   :::.   |||:|.|     .:.|..    ||.      :|...|..|...|..:..
Mouse   231 ---DDCTVGYIIECKLGGRLQPS-----PLFHSH----LET------LQLLGAAQLPEQVTLSYG 277

  Fly   314 KYEKHGSFCVETEKFPDAMNHPEFPSISLEPNEKYR--HDVLY 354
            .:|..    :...|.|...:|.|.||       ::|  |.:||
Mouse   278 VFEGK----LNVIKLPGPFSHEEDPS-------RFRSLHCLLY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32444NP_730670.1 galactose_mutarotase_like 26..356 CDD:185696 51/238 (21%)
MfngNP_032621.1 Fringe 51..300 CDD:190308 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.