DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and ORM1

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_011552.1 Gene:ORM1 / 852926 SGDID:S000003270 Length:222 Species:Saccharomyces cerevisiae


Alignment Length:138 Identity:47/138 - (34%)
Similarity:75/138 - (54%) Gaps:2/138 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFLHVIKGAPWLST 76
            |.|::|:..||.|:.:::.::.:.|.:...|.|:..|:||.||:.:........|:|||.|: ..
Yeast    74 NMNATWVDQRGAWIIHVVIIILLKLFYNLFPGVTTEWSWTLTNMTYVIGSYVMFHLIKGTPF-DF 137

  Fly    77 ENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPN-FISLVVVTLPKL 140
            ........|.||||||....|.:||||.:|||.|||::..|...:.:.|..| |::.....:|||
Yeast   138 NGGAYDNLTMWEQIDDETLYTPSRKFLISVPIALFLVSTHYAHYDLKLFSWNCFLTTFGAVVPKL 202

  Fly   141 PQFHGVRL 148
            |..|.:|:
Yeast   203 PVTHRLRI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 46/135 (34%)
ORM1NP_011552.1 COG5081 42..222 CDD:227413 47/138 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346349
Domainoid 1 1.000 89 1.000 Domainoid score I1793
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57032
Inparanoid 1 1.050 89 1.000 Inparanoid score I1554
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54404
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm46767
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - LDO PTHR12665
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.