DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and ORM2

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_013454.1 Gene:ORM2 / 851064 SGDID:S000004342 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:141 Identity:50/141 - (35%)
Similarity:77/141 - (54%) Gaps:9/141 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NPNSSWLSARGFWLAYLLGLLSVHL---LFLSVPFVSIPWAWTATNLLHNAAHLYFLHVIKGAPW 73
            |.|::|:..||.||.:::.::.:.|   ||.|.|    .|.||.||:.:........|::||.|:
Yeast    69 NMNATWVDQRGAWLIHIVVIVLLRLFYSLFGSTP----KWTWTLTNMTYIIGFYIMFHLVKGTPF 129

  Fly    74 LSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNF-ISLVVVTL 137
             ..........|.||||:|....|.|||||..|||||||::..|.||:...|:.|. :::::..:
Yeast   130 -DFNGGAYDNLTMWEQINDETLYTPTRKFLLIVPIVLFLISNQYYRNDMTLFLSNLAVTVLIGVV 193

  Fly   138 PKLPQFHGVRL 148
            |||...|.:|:
Yeast   194 PKLGITHRLRI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 49/138 (36%)
ORM2NP_013454.1 COG5081 37..216 CDD:227413 50/141 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346350
Domainoid 1 1.000 89 1.000 Domainoid score I1793
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57032
Inparanoid 1 1.050 89 1.000 Inparanoid score I1554
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54404
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm46767
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - O PTHR12665
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.