DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and AT1G01230

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_563622.1 Gene:AT1G01230 / 839331 AraportID:AT1G01230 Length:157 Species:Arabidopsis thaliana


Alignment Length:143 Identity:52/143 - (36%)
Similarity:74/143 - (51%) Gaps:1/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFLHVIKGAPWL 74
            :.|.|:.|....|.|..|:|.|....|:.|||...|...|||..||.|.....:..|.:||.|: 
plant    13 DMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAHFVVTYHSFHWMKGTPF- 76

  Fly    75 STENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNFISLVVVTLPK 139
            :.:.......|.|||:|:|.|:|..|||||.||:||:|:....|.........|.::::|:.:.|
plant    77 ADDQGIYNGLTWWEQMDNGQQLTRNRKFLTLVPVVLYLIASHTTDYRHPWLFLNTLAVMVLVVAK 141

  Fly   140 LPQFHGVRLFNIN 152
            .|..|.||:|.||
plant   142 FPNMHKVRIFGIN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 47/134 (35%)
AT1G01230NP_563622.1 ORMDL 15..149 CDD:397947 47/134 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2746
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I2231
OMA 1 1.010 - - QHG54404
OrthoDB 1 1.010 - - D1405600at2759
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm3485
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - LDO PTHR12665
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1334
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.