DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and ormdl3

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001006087.1 Gene:ormdl3 / 450067 ZFINID:ZDB-GENE-041010-190 Length:153 Species:Danio rerio


Alignment Length:152 Identity:79/152 - (51%)
Similarity:108/152 - (71%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFLHV 67
            ::...|.|.|||:..:::||.||:|:||:..:|::.||:||||:|..||.|||:||.....|||.
Zfish     2 NVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHT 66

  Fly    68 IKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNFISL 132
            :||.|:.:.:...:|..|||||:|.|||.|.:|||||..||:|:.||..||:.:..||:.|.|||
Zfish    67 VKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYDRVHFVINTISL 131

  Fly   133 VVVTLPKLPQFHGVRLFNINKY 154
            :.|.:||||||||||||.||||
Zfish   132 LTVLIPKLPQFHGVRLFGINKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 69/134 (51%)
ormdl3NP_001006087.1 ORMDL 11..146 CDD:281982 69/134 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595494
Domainoid 1 1.000 162 1.000 Domainoid score I3954
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57032
Inparanoid 1 1.050 180 1.000 Inparanoid score I3987
OMA 1 1.010 - - QHG54404
OrthoDB 1 1.010 - - D1405600at2759
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm25343
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - O PTHR12665
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 1 1.000 - - X1334
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.