DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and ORMDL2

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_054901.1 Gene:ORMDL2 / 29095 HGNCID:16037 Length:153 Species:Homo sapiens


Alignment Length:154 Identity:80/154 - (51%)
Similarity:108/154 - (70%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIAGGHGEANPNSSWLSARGFWLAY--LLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFL 65
            ::...|.|.|||:..:::||.||||  |:|||  |::.||:||.|||..||.||::||.|...||
Human     2 NVGVAHSEVNPNTRVMNSRGIWLAYIILVGLL--HMVLLSIPFFSIPVVWTLTNVIHNLATYVFL 64

  Fly    66 HVIKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNFI 130
            |.:||.|:.:.:...:|..|||||:|.|:|.|::||||:..||||:||...||:.:..||:.|..
Human    65 HTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTA 129

  Fly   131 SLVVVTLPKLPQFHGVRLFNINKY 154
            ||:.|.|||||||||||:|.||||
Human   130 SLLSVLLPKLPQFHGVRVFGINKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 71/136 (52%)
ORMDL2NP_054901.1 ORMDL 11..146 CDD:281982 71/136 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4179
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I4080
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54404
OrthoDB 1 1.010 - - D1405600at2759
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm41169
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12665
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 1 1.000 - - X1334
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.970

Return to query results.
Submit another query.