DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and Ormdl1

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_663492.3 Gene:Ormdl1 / 227102 MGIID:2181669 Length:153 Species:Mus musculus


Alignment Length:152 Identity:73/152 - (48%)
Similarity:103/152 - (67%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFLHV 67
            ::...|.|.|||:..:::||.||.|.||:..:|::.||:||.|:|.|||.||::||.....|||.
Mouse     2 NVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSVPVAWTLTNIIHNLGMYVFLHA 66

  Fly    68 IKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNFISL 132
            :||.|:.:.:...:|..|||||:|.|||.|::|||.|..||:|:.|...||:.:..|||.|..||
Mouse    67 VKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTISPIILYFLASFYTKYDPTHFILNTASL 131

  Fly   133 VVVTLPKLPQFHGVRLFNINKY 154
            :.|.:||:||.||||:|.||||
Mouse   132 LSVLIPKMPQLHGVRIFGINKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 64/134 (48%)
Ormdl1NP_663492.3 ORMDL 11..146 CDD:367791 64/134 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849714
Domainoid 1 1.000 157 1.000 Domainoid score I4149
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4064
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54404
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm43239
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - LDO PTHR12665
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 1 1.000 - - X1334
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.