DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and Ormdl1

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_038938825.1 Gene:Ormdl1 / 100188936 RGDID:2300146 Length:413 Species:Rattus norvegicus


Alignment Length:56 Identity:27/56 - (48%)
Similarity:41/56 - (73%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHN 58
            ::...|.|.|||:..:::||.||.|.||:..:|::|||:||.|:|.|||.||::||
  Rat     2 NVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVFLSIPFCSVPVAWTLTNIIHN 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 25/47 (53%)
Ormdl1XP_038938825.1 ORMDL 11..>60 CDD:413202 25/47 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353368
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5081
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1405600at2759
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102694
Panther 1 1.100 - - LDO PTHR12665
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.