DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ORMDL and ormdl1

DIOPT Version :9

Sequence 1:NP_730669.1 Gene:ORMDL / 40404 FlyBaseID:FBgn0037110 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001096387.1 Gene:ormdl1 / 100124987 XenbaseID:XB-GENE-948314 Length:153 Species:Xenopus tropicalis


Alignment Length:152 Identity:75/152 - (49%)
Similarity:104/152 - (68%) Gaps:0/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIAGGHGEANPNSSWLSARGFWLAYLLGLLSVHLLFLSVPFVSIPWAWTATNLLHNAAHLYFLHV 67
            ::...|.|.|||:..:::||.||.|.||:..:|::.||:||.|:|.|||.||::||.....|||.
 Frog     2 NVGVAHSEVNPNTRVMNSRGMWLTYALGVGMLHIVLLSIPFFSVPVAWTLTNVIHNLGMYVFLHA 66

  Fly    68 IKGAPWLSTENDPSRRWTHWEQIDDGVQMTTTRKFLTAVPIVLFLLTCLYTRNNTEHFIPNFISL 132
            :||.|:.:.:...:|..|||||:|.|||.|::|||||..||:|:.||..||:.:..||..|..||
 Frog    67 VKGTPFETPDQGKARLLTHWEQLDYGVQFTSSRKFLTISPIILYFLTSFYTKYDPTHFFINTASL 131

  Fly   133 VVVTLPKLPQFHGVRLFNINKY 154
            :.|.:|||||.||||:|.||||
 Frog   132 LSVLIPKLPQLHGVRIFGINKY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ORMDLNP_730669.1 ORMDL 12..147 CDD:281982 66/134 (49%)
ormdl1NP_001096387.1 ORMDL 11..146 CDD:367791 66/134 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4253
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4006
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1405600at2759
OrthoFinder 1 1.000 - - FOG0001304
OrthoInspector 1 1.000 - - otm48381
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1721
SonicParanoid 1 1.000 - - X1334
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.