DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg11 and piga

DIOPT Version :9

Sequence 1:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001119918.1 Gene:piga / 791759 ZFINID:ZDB-GENE-040426-1086 Length:487 Species:Danio rerio


Alignment Length:237 Identity:41/237 - (17%)
Similarity:93/237 - (39%) Gaps:75/237 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 TWTKLAYYRLFSRMYKWVGCCAETIMVNSSWTENHILQLWDV-PFKTHRVYPP--CEVSHLKSLQ 273
            :::.:|:..||.         |:|:.:|:.:|::.:....|: ...|:::...  |:.:|:..:.
Zfish   134 SFSAMAHDALFH---------AKTMGLNTVFTDHSLFGFADLSSVLTNKLLTVSLCDTNHIVCVS 189

  Fly   274 HTEKGDEFI-------ILSV-------GQFRPE---KDHPLQLQAIYELRTLLAQDEALWNQIKL 321
            :|.|.:..:       |:||       ..|.|:   :|:                     ::|.:
Zfish   190 YTSKENTVLRATLDPEIVSVIPNAVDPTDFTPDPCRRDN---------------------SKITI 233

  Fly   322 VIVGS-----------------CRNEDDY------ERLKN--MQDLTKHLSLENNVQFSVNVPYE 361
            |::..                 |....|.      |..|.  ::::.:...|.:.|:....:.::
Zfish   234 VVISRLVYRKGIDLLSGIIPELCGRHPDLCFLIGGEGPKRIILEEVREKYQLHDRVRLLGALDHK 298

  Fly   362 DLLKLYQTAHIGIHTMWNEHFGIGIVESMAAGLIMVAHKSGG 403
            |:..:....||.::|...|.|.:.|||..:.||.:|:.:.||
Zfish   299 DVRDVLVQGHIFLNTSLTEAFCMAIVEGASCGLQVVSTRVGG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 41/237 (17%)
GT1_ALG11_like 44..463 CDD:99978 41/237 (17%)
pigaNP_001119918.1 GT1_PIG-A_like 38..437 CDD:99970 41/237 (17%)
RfaB 39..409 CDD:223515 41/237 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.