DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg11 and ALG1L2

DIOPT Version :9

Sequence 1:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001129624.1 Gene:ALG1L2 / 644974 HGNCID:37258 Length:215 Species:Homo sapiens


Alignment Length:107 Identity:21/107 - (19%)
Similarity:42/107 - (39%) Gaps:34/107 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LKQRH---------WIEAKNYPHFTLLGQSIGSMVVGLEALCRFPPDIYIDTMGYAFTYP----- 165
            :.|:|         |:|.:..|  .|||.      |.|        |:.:||.......|     
Human   117 IHQKHFQHIQVCIPWLEGRGLP--PLLGS------VDL--------DVCLDTSSSGLDLPMKVVD 165

  Fly   166 LFRYLAQSKVGCYVHYPVISTDMLKRVQQRQMSHNNKKYVAR 207
            :||....:   |.|::..:. :::|..:.|.:..::::..|:
Human   166 MFRCCLPA---CAVNFKCLH-ELVKHEENRLVFEDSEELAAQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 21/107 (20%)
GT1_ALG11_like 44..463 CDD:99978 21/107 (20%)
ALG1L2NP_001129624.1 Glycosyltransferase_GTB_type <8..206 CDD:299143 21/107 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..66
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.