DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg11 and GlyS

DIOPT Version :9

Sequence 1:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_731967.2 Gene:GlyS / 41823 FlyBaseID:FBgn0266064 Length:709 Species:Drosophila melanogaster


Alignment Length:259 Identity:52/259 - (20%)
Similarity:83/259 - (32%) Gaps:112/259 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 WDVPFKTHRVYPPCEVSHLKSLQHTEK-GDEFIILSVGQFRPEKDH---------------PLQL 299
            |:|..|...:|   .|...|:...||: |::..::.     |.|:|               || |
  Fly    56 WEVANKVGGIY---TVIRSKAYVSTEEMGEQLCMMG-----PYKEHCARTEMEEMEFPRGNPL-L 111

  Fly   300 QAI-------YELRTLLAQDEALW-----NQIKLVIVGSCRNEDDYERLKNMQDLTKHLSLENNV 352
            .|:       |::.|      ..|     .|:.|..:||...:.|                    
  Fly   112 DAVNSLRSRGYKIHT------GRWLVDGNPQLILFDIGSAAWKLD-------------------- 150

  Fly   353 QFSVNVPYEDLLKLYQTAHIGIHTMWNEHFGIGIVESMAAGLIMVAHKSGGPLLDIVETSAGSQN 417
            ||.        .::::..||||                             |.||| ||:.....
  Fly   151 QFK--------SEMWEKCHIGI-----------------------------PHLDI-ETNDAIIL 177

  Fly   418 GFLATDAVEYAENILNIIVNNSEMNGIRNAARASVERFSEQE------FEKNFLRAVSTLFTNN 475
            ||:   ..|:.|...|..|..|:.|.:  :|...|..|.|.:      ..:..|..::|:||.:
  Fly   178 GFM---IAEFLEEFRNFAVTYSQNNEL--SAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 50/255 (20%)
GT1_ALG11_like 44..463 CDD:99978 48/245 (20%)
GlySNP_731967.2 Glycogen_syn 53..697 CDD:399009 52/259 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.