DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg11 and Piga

DIOPT Version :9

Sequence 1:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_006256932.1 Gene:Piga / 363464 RGDID:1589723 Length:485 Species:Rattus norvegicus


Alignment Length:357 Identity:67/357 - (18%)
Similarity:132/357 - (36%) Gaps:100/357 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PLFRYLAQSKVGCYVHYPVISTDMLKRVQQRQMSHNNKKYVARNPFLTWTKLAYYRLFSRMYKWV 229
            ||.||:...:....:|                 ||:           :::.:|:..||.      
  Rat   111 PLLRYIFVRERITIIH-----------------SHS-----------SFSAMAHDALFH------ 141

  Fly   230 GCCAETIMVNSSWTENHILQLWDV-PFKTHRVYPP--CEVSHLKSLQHTEKGDEFI-------IL 284
               |:|:.:.:.:|::.:....|| ...|:::...  |:.:|:..:.:|.|.:..:       |:
  Rat   142 ---AKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIV 203

  Fly   285 SV-------GQFRPE--KDHPLQLQAIYELRTLLAQDEALWNQIKLVIVGSCRNEDDYERLK--- 337
            ||       ..|.||  :.|...:..:...|.:..:...|   :..:|...|:.   |:.|.   
  Rat   204 SVIPNAVDPTDFTPEPFRRHDSVITVVVVSRLVYRKGTDL---LSGIIPELCQK---YQELNFLI 262

  Fly   338 --------NMQDLTKHLSLENNVQFSVNVPYEDLLKLYQTAHIGIHTMWNEHFGIGIVESMAAGL 394
                    .::::.:...|.:.||....:.::|:..:....||.::|...|.|.:.|||:.:.||
  Rat   263 GGEGPKRIILEEVRERYQLHDRVQLLGALEHKDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGL 327

  Fly   395 IMVAHKSGG-------PLLDIVETSAGS------------QNGFLATDAVEYAENILNIIVNNSE 440
            .:|:.|.||       .|:.:.|.|..|            ::|.|..     .|||.|::.....
  Rat   328 QVVSTKVGGIPEVLPENLIILCEPSVKSLCEGLEKAIFQVKSGTLPA-----PENIHNVVKTFYT 387

  Fly   441 MNGIRNAARASVERFSEQE---FEKNFLRAVS 469
            ...:........||.|::.   ..|...|.:|
  Rat   388 WRNVAERTEKVYERVSKESVLPMHKRLDRLIS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 67/357 (19%)
GT1_ALG11_like 44..463 CDD:99978 64/349 (18%)
PigaXP_006256932.1 GT4_PIG-A-like 34..433 CDD:340827 67/357 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.