DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and SIGLEC6

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_011525835.1 Gene:SIGLEC6 / 946 HGNCID:10875 Length:464 Species:Homo sapiens


Alignment Length:356 Identity:76/356 - (21%)
Similarity:123/356 - (34%) Gaps:94/356 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLSLIGGSFILPENDPPTTAPKFLSRGHLYKVIVGETIEL-------PCKVQNLGSFVLLWRKGS 76
            ||::..|..:|.....|||.|... .|:.|..:.|..:.:       ..:.:..|.|.|||    
Human    38 SLTVQEGLCVLVPCRLPTTLPASY-YGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLW---- 97

  Fly    77 SVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQL-------GDQENRDQV------HT 128
                        |.|.|   :.:|.|...:.:|...|..:|       |...::..|      |.
Human    98 ------------DPRRK---NCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHR 147

  Fly   129 VEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHL----SDSSTLI 189
            ..|.:|.||.: .|...:|.    :|...|: .|.| |...|..    :.||.|    :.||.|.
Human   148 PNISIPGTLES-GHPSNLTC----SVPWVCE-QGTP-PIFSWMS----AAPTSLGPRTTQSSVLT 201

  Fly   190 LENVDRHHAGTYQCSAD-NGVKDRVSMDIQLTI--------LSPPE------------------I 227
            :....:.|:....|... .|....:...|||.:        ||.|:                  |
Human   202 ITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSWMLRRPPLSTPDAPQKVAISIFQGNSAAFKI 266

  Fly   228 TVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDF 292
            ....|.:...||..:.|:|...|:..:.:.|:|....|:||      |..:...|.:......:.
Human   267 LQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNAT------PISNTGVLELPQVGSAEE 325

  Fly   293 GNYSCVADNALGRTKKYIEV------SGRPG 317
            |:::|.|.:.||..:..:.:      .||.|
Human   326 GDFTCRAQHPLGSLQISLSLFVHWKPEGRAG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 18/102 (18%)
Ig 56..116 CDD:143165 12/66 (18%)
IG_like 144..221 CDD:214653 19/81 (23%)
IGc2 151..209 CDD:197706 14/62 (23%)
IG_like 232..313 CDD:214653 18/86 (21%)
Ig 242..311 CDD:143165 15/68 (22%)
SIGLEC6XP_011525835.1 Ig 31..141 CDD:299845 26/122 (21%)
IG_like 36..141 CDD:214653 26/122 (21%)
Ig_3 147..218 CDD:290638 20/81 (25%)
I-set 265..347 CDD:254352 19/87 (22%)
Ig 277..347 CDD:299845 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.