DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and SIGLEC5

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_016882908.1 Gene:SIGLEC5 / 8778 HGNCID:10874 Length:560 Species:Homo sapiens


Alignment Length:370 Identity:70/370 - (18%)
Similarity:115/370 - (31%) Gaps:111/370 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLGSFVLLWRKGSS--------------------VLTAG---HLKITRDQRFKI 94
            |..:.:||      ||...||...|                    |.|..   .:|.....||::
Human    34 GLCVLVPC------SFSYPWRSWYSSPPLYVYWFRDGEIPYYAEVVATNNPDRRVKPETQGRFRL 92

  Fly    95 VGDY-----NLQINGVKTQDAGDYICQL--------GDQENRDQVHTVEILVPPTLRALPHNGQV 146
            :||.     :|.|...:.:|.|.|..::        ..|:|:..:....::..|.:..|.     
Human    93 LGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVTALIEKPDIHFLE----- 152

  Fly   147 TARKGSTVTLECKASGN----PVPTIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSAD- 206
            ....|....|.|...|:    |..|..|....:.......:.||.|.|......|.....|... 
Human   153 PLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQMKR 217

  Fly   207 NGVKDRVSMDIQLTILSPP------------EITVEKSWVHASEGYDVELVCIVHGDVNSEMLWY 259
            .|.:......:||.:...|            ||....|::...||..:.|:|....:..:.:.|:
Human   218 QGAQVTTERTVQLNVSYAPQTITIFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWF 282

  Fly   260 QNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKKYIEVS----------- 313
            |.|..|:||      |..:...|.:|..:..:.|.::|.|.:.||..:.::.:|           
Human   283 QGSPALNAT------PISNTGILELRRVRSAEEGGFTCRAQHPLGFLQIFLNLSVYSLPQLLGPS 341

  Fly   314 ---------------GRPGPADFISPALSGFLDHYNLTWTIESIP 343
                           .||.|               :|.|.:|..|
Human   342 CSWEAEGLHCRCSFRARPAP---------------SLCWRLEEKP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 22/115 (19%)
Ig 56..116 CDD:143165 19/87 (22%)
IG_like 144..221 CDD:214653 16/81 (20%)
IGc2 151..209 CDD:197706 13/62 (21%)
IG_like 232..313 CDD:214653 19/80 (24%)
Ig 242..311 CDD:143165 16/68 (24%)
SIGLEC5XP_016882908.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.