DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and CILP

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_016878167.1 Gene:CILP / 8483 HGNCID:1980 Length:1211 Species:Homo sapiens


Alignment Length:198 Identity:46/198 - (23%)
Similarity:76/198 - (38%) Gaps:55/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 IELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQLGDQ 120
            :.||......|:.:.|..|...:||    :...|.||:|.|                 :|    .
Human   257 VSLPGGAPASGAAIYLLTKTPKLLT----QTDSDGRFRIPG-----------------LC----P 296

  Fly   121 ENRDQVHTVEILVPPTLRALPH----------------------NGQVTARK-GSTVTLECKASG 162
            :.:..:...::...|.:..:|.                      |.:..||: |.:|:|.|||:|
Human   297 DGKSILKITKVKFAPIVLTMPKTSLKAATIKAEFVRAETPYMVMNPETKARRAGQSVSLCCKATG 361

  Fly   163 NPVP-TIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADN---GVKDRVSMDIQLTILS 223
            .|.| ..||:..|....|:.....|.|:|..:.:|.||.|.|.|.:   .||.:|:   ||.:::
Human   362 KPRPDKYFWYHNDTLLDPSLYKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVA---QLIVIA 423

  Fly   224 PPE 226
            ..|
Human   424 SDE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 13/76 (17%)
Ig 56..116 CDD:143165 12/59 (20%)
IG_like 144..221 CDD:214653 29/81 (36%)
IGc2 151..209 CDD:197706 22/61 (36%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
CILPXP_016878167.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7834
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.