Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016878167.1 | Gene: | CILP / 8483 | HGNCID: | 1980 | Length: | 1211 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 46/198 - (23%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 55/198 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 IELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQLGDQ 120
Fly 121 ENRDQVHTVEILVPPTLRALPH----------------------NGQVTARK-GSTVTLECKASG 162
Fly 163 NPVP-TIFWFKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADN---GVKDRVSMDIQLTILS 223
Fly 224 PPE 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 13/76 (17%) |
Ig | 56..116 | CDD:143165 | 12/59 (20%) | ||
IG_like | 144..221 | CDD:214653 | 29/81 (36%) | ||
IGc2 | 151..209 | CDD:197706 | 22/61 (36%) | ||
IG_like | 232..313 | CDD:214653 | |||
Ig | 242..311 | CDD:143165 | |||
CILP | XP_016878167.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S7834 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |