DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:233 Identity:63/233 - (27%)
Similarity:97/233 - (41%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 APKFLSRGHLYKVIVGETIELPCKVQNLGSF--VLLWRKGSSVLTAGHLKITRDQRFKIVGD--- 97
            :|.||.:.....|::||...|||.   ||::  ::.|.| |.:...|...:....|:.|.|:   
Human    23 SPHFLQQPEDLVVLLGEEARLPCA---LGAYWGLVQWTK-SGLALGGQRDLPGWSRYWISGNAAN 83

  Fly    98 --YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKA 160
              ::|.|..|:.:|...|.||......|.:...:.:||||....:.....|:...|....|.|::
Human    84 GQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLVAGVPANLTCRS 148

  Fly   161 SGN--PVPTIFWFKKDV-FSGPT-HL---------SDSSTLILENVDRHHAGTYQCSADNGV--- 209
            .|:  |.|.:.||:..| ..|.| |.         |..|||.|.........|:.|.|.:..   
Human   149 RGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRARSQALPT 213

  Fly   210 -KDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVC 246
             :|..   |.|::..|||:|:..|.....||..|..:|
Human   214 GRDTA---ITLSLQYPPEVTLSASPHTVQEGEKVIFLC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/89 (26%)
Ig 56..116 CDD:143165 17/66 (26%)
IG_like 144..221 CDD:214653 24/93 (26%)
IGc2 151..209 CDD:197706 20/70 (29%)
IG_like 232..313 CDD:214653 5/15 (33%)
Ig 242..311 CDD:143165 2/5 (40%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 23/92 (25%)
IGc2 38..106 CDD:197706 21/71 (30%)
I-set 126..224 CDD:254352 24/100 (24%)
Ig2_KIRREL3-like 141..223 CDD:143236 22/84 (26%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845 5/18 (28%)
IG_like 234..308 CDD:214653 5/15 (33%)
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.