Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_954649.3 | Gene: | KIRREL2 / 84063 | HGNCID: | 18816 | Length: | 708 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 63/233 - (27%) |
---|---|---|---|
Similarity: | 97/233 - (41%) | Gaps: | 31/233 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 APKFLSRGHLYKVIVGETIELPCKVQNLGSF--VLLWRKGSSVLTAGHLKITRDQRFKIVGD--- 97
Fly 98 --YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKA 160
Fly 161 SGN--PVPTIFWFKKDV-FSGPT-HL---------SDSSTLILENVDRHHAGTYQCSADNGV--- 209
Fly 210 -KDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVC 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 23/89 (26%) |
Ig | 56..116 | CDD:143165 | 17/66 (26%) | ||
IG_like | 144..221 | CDD:214653 | 24/93 (26%) | ||
IGc2 | 151..209 | CDD:197706 | 20/70 (29%) | ||
IG_like | 232..313 | CDD:214653 | 5/15 (33%) | ||
Ig | 242..311 | CDD:143165 | 2/5 (40%) | ||
KIRREL2 | NP_954649.3 | IG_like | 30..119 | CDD:214653 | 23/92 (25%) |
IGc2 | 38..106 | CDD:197706 | 21/71 (30%) | ||
I-set | 126..224 | CDD:254352 | 24/100 (24%) | ||
Ig2_KIRREL3-like | 141..223 | CDD:143236 | 22/84 (26%) | ||
Cell attachment site. /evidence=ECO:0000255 | 149..151 | 0/1 (0%) | |||
Ig | 231..306 | CDD:299845 | 5/18 (28%) | ||
IG_like | 234..308 | CDD:214653 | 5/15 (33%) | ||
Ig | 312..395 | CDD:299845 | |||
I-set | 317..395 | CDD:254352 | |||
Ig | 397..501 | CDD:299845 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 545..601 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |