DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:304 Identity:93/304 - (30%)
Similarity:147/304 - (48%) Gaps:25/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IGGSFILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLWR--KGSSVLTAGHLK 85
            :|||.:   |:..:..|:|........|..|..::|.|.|:||||:.:.|.  :.|::||..:..
  Fly    39 VGGSTL---NNVISEDPEFTDVIENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHV 100

  Fly    86 ITRDQRFKIVGD-------YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHN 143
            |||:.|..:..|       :.|.||.|:.:|.|.|:||:.....:.|...|:::|||.:.....:
  Fly   101 ITRNPRISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTS 165

  Fly   144 GQVTARKGSTVTLECKASGNPVPTIFWFKKD---VFSGPT---HLSDSSTLILENVDRHHAGTYQ 202
            ..:..|:|..|||.|||.|:|.|||.|.:.|   :....|   |..::.:|.||.:.|.|.|.|.
  Fly   166 SDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYL 230

  Fly   203 CSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLW-YQNSFLLD 266
            |.|.|||...||..|::::...|.:.:....|....|:::.|.|.:..:..|...| .:|..::.
  Fly   231 CIASNGVPPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMIT 295

  Fly   267 ATD--RRSMYPRDDRYS----LIIRNFQPTDFGNYSCVADNALG 304
            .:.  :....|....|.    |.|.|.|.:|:|||.|||.|..|
  Fly   296 ESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRG 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 29/91 (32%)
Ig 56..116 CDD:143165 23/68 (34%)
IG_like 144..221 CDD:214653 32/82 (39%)
IGc2 151..209 CDD:197706 26/63 (41%)
IG_like 232..313 CDD:214653 22/80 (28%)
Ig 242..311 CDD:143165 20/70 (29%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 29/95 (31%)
Ig 69..139 CDD:143165 24/69 (35%)
IG_like 165..249 CDD:214653 32/83 (39%)
IGc2 172..237 CDD:197706 26/64 (41%)
IG_like 267..348 CDD:214653 21/73 (29%)
Ig 270..339 CDD:299845 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.