DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:306 Identity:91/306 - (29%)
Similarity:133/306 - (43%) Gaps:34/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PKFLSRGHLYKVIVGETIELPCKVQNLGSFVLLW----RKGSSVLTAGHLKITRDQRFKIVGDYN 99
            |:|........|.||....|||.|::||.:.:.|    |:  .:||.....|:|..|:.|....|
  Fly    44 PRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQ--MILTIHRHVISRIPRYSITYTDN 106

  Fly   100 ---LQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHN-GQVTARKGSTVTLECKA 160
               |.:|.....|.|.|:||:.......||..::::|||.:..:... ..|..|:...:.:.|:|
  Fly   107 TWLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRA 171

  Fly   161 SGNPVPTIFWFKKD-------------VFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDR 212
            .|.|.|.|.|.::|             |:       |:..|.|..|.|:..|.|.|.|.|||...
  Fly   172 DGFPAPKIIWRREDGEEIAVEKKKKVLVY-------DADVLPLTKVSRNEMGAYLCIATNGVPPS 229

  Fly   213 VSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRD 277
            ||..|.|.:...|.|.|....|.|..|.||.:.|.......:.:.|..||.::..:.:......:
  Fly   230 VSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKTDYTE 294

  Fly   278 DRY----SLIIRNFQPTDFGNYSCVADNALGRTKKYIEVSGRPGPA 319
            :.|    .|.|||.|..|||||.|::.|:||.|:..|.|...|.|:
  Fly   295 NSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 27/89 (30%)
Ig 56..116 CDD:143165 20/66 (30%)
IG_like 144..221 CDD:214653 27/89 (30%)
IGc2 151..209 CDD:197706 19/70 (27%)
IG_like 232..313 CDD:214653 26/84 (31%)
Ig 242..311 CDD:143165 21/72 (29%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 27/93 (29%)
Ig 145..238 CDD:416386 28/99 (28%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 1/4 (25%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 1/1 (100%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/5 (40%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 4/7 (57%)
Ig 242..333 CDD:416386 29/90 (32%)
Ig strand A' 250..253 CDD:409353 1/2 (50%)
Ig strand B 259..266 CDD:409353 2/6 (33%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 2/9 (22%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
32.810

Return to query results.
Submit another query.