DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and aebp1b

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:346 Identity:79/346 - (22%)
Similarity:114/346 - (32%) Gaps:89/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VGETIELPCKV----QNLGSFVLLW--RKGSSVLTA-GHLKITRDQRFKIVGDY--NLQINGVKT 107
            ||:..:|.|||    :|:.     |  ..|..|||. |:||:...      |..  :|.:.....
Zfish    69 VGQHKQLLCKVSSDAKNIN-----WVSPNGEKVLTKHGNLKVHNH------GSVLSSLTVLNANL 122

  Fly   108 QDAGDYICQL--GDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFW 170
            .:||.|.|..  ||.|::..| .::|::....|.       |.|||....|:     .|.|:   
Zfish   123 NNAGIYKCVATNGDTESQATV-KLDI
ILKRMRRD-------TDRKGREKRLK-----EPKPS--- 171

  Fly   171 FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVH 235
             ||...|.||....|     |...:...|    ....|.|:|.......|....|..||...:  
Zfish   172 -KKPKASKPTKKPKS-----EKKGKGEKG----GKKKGKKNREESTTVATTTVAPTTTVPMEY-- 224

  Fly   236 ASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVAD 300
             .|.||.|.......|..:|......:........:...|..|.||      ||..:.:|..|.:
Zfish   225 -EEFYDPEPDQYWDEDFPAETTTVARTTTTPTEKTKDFIPDMDEYS------QPDSYDDYWKVDE 282

  Fly   301 NALGRTKKYIEVSGRPGPADFISPA----------------LSGFLDHYNLTWTIE-SIPPLDEI 348
                .|.....::|||...|....|                :|...:.:..|.|.| ::||.:  
Zfish   283 ----PTPTTSVIAGRPADDDDYWDARSVEMVENLPFPDGKEISSTDNDWQYTTTEEPTVPPFE-- 341

  Fly   349 KLLYRRLLMNETYQHPGKWHE 369
                     |..|:.....||
Zfish   342 ---------NSWYEEYEYGHE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 26/91 (29%)
Ig 56..116 CDD:143165 18/68 (26%)
IG_like 144..221 CDD:214653 18/76 (24%)
IGc2 151..209 CDD:197706 12/57 (21%)
IG_like 232..313 CDD:214653 15/80 (19%)
Ig 242..311 CDD:143165 12/68 (18%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 25/89 (28%)
IG_like 62..145 CDD:214653 25/87 (29%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.