DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and robo4

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:212 Identity:62/212 - (29%)
Similarity:89/212 - (41%) Gaps:42/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NRDQVH-------TVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWF-------- 171
            :||:.|       ..||.:|   |.:.|...|..|.||..||.|:|.|||.|||.|.        
Zfish    52 HRDRAHRRKGSRLVSEINLP---RIVHHPSDVVVRVGSPATLSCRAEGNPEPTIQWLRNGQPLDT 113

  Fly   172 -KKDVFSGPTHLSDSSTLILENV----DRHHAGTYQCSADNGVKDRVSMDIQLTILSPPE-ITVE 230
             |.|..|.|..|.|.|......|    .:.|...|.|.|.|.:.:..|.:..|.|.:..| ..|:
Zfish   114 DKMDAQSQPIVLPDGSLFFFSVVPGRKGQSHEAVYACIAHNSIGNATSRNASLHIAALREDFRVQ 178

  Fly   231 KSWVHASEGYDVELVC---IVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYS-----LIIRNF 287
            .|.|..:.|....:.|   :.|.:.|  :.|.::..|::::        ::.|:     |||...
Zfish   179 PSDVEVAIGEMATINCSPPVGHPEPN--VTWRKDGILINSS--------NEHYTELKGKLIIAPA 233

  Fly   288 QPTDFGNYSCVADNALG 304
            |..|.|.|||:|.|.:|
Zfish   234 QKNDSGVYSCIASNMIG 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 5/17 (29%)
Ig 56..116 CDD:143165
IG_like 144..221 CDD:214653 30/89 (34%)
IGc2 151..209 CDD:197706 26/70 (37%)
IG_like 232..313 CDD:214653 21/81 (26%)
Ig 242..311 CDD:143165 18/71 (25%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 33/101 (33%)
I-set 71..168 CDD:254352 33/99 (33%)
I-set 175..261 CDD:254352 22/86 (26%)
Ig2_Robo 177..261 CDD:143201 22/84 (26%)
I-set 265..350 CDD:254352
Ig 282..350 CDD:299845
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.