DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7166 and lrit3a

DIOPT Version :9

Sequence 1:	NP_001262181.1	Gene:	CG7166 / 40401	FlyBaseID:	FBgn0037107	Length:	467	Species:	Drosophila melanogaster
Sequence 2:	NP_001122166.1	Gene:	lrit3a / 558559	ZFINID:	ZDB-GENE-080723-63	Length:	636	Species:	Danio rerio

Alignment Length:	113	Identity:	35/113 - (30%)
Similarity:	50/113 - (44%)	Gaps:	17/113 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   133 VPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKD--------VFSGPTHLSDSSTLI 189
            |.||:  :....::|:..||.|.|.|.|:|.|.||:.|...|        |...|......|.|.
Zfish   250 VKPTV--MTSATKITSPLGSNVLLRCDANGFPTPTLLWTTADGSVVNNTVVQESPGEGVRWSILS 312

  Fly   190 LENVDRHHAGTYQCSADNGVKD-----RVSMD-IQLTILSPPEITVEK 231
            |.::....||.|:|.|.|...:     .:|:| :|.|...|| |.:.|
Zfish   313 LHSIVFKDAGDYRCKAKNVAGNAEAYITLSVDGVQPTTPFPP-INITK 359

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7166	NP_001262181.1	IG_like	50..133	CDD:214653	35/113 (31%)
		Ig	56..116	CDD:143165
		IG_like	144..221	CDD:214653	27/90 (30%)
		IGc2	151..209	CDD:197706	23/65 (35%)
		IG_like	232..313	CDD:214653	35/113 (31%)
		Ig	242..311	CDD:143165
lrit3a	NP_001122166.1	LRR_8	81..141	CDD:290566
		leucine-rich repeat	83..106	CDD:275378
		LRR_4	107..145	CDD:289563
		leucine-rich repeat	107..130	CDD:275378
		LRR_8	129..>171	CDD:290566
		LRR_4	129..170	CDD:289563
		leucine-rich repeat	131..154	CDD:275378
		leucine-rich repeat	155..168	CDD:275378
		TPKR_C2	199..249	CDD:301599
		Ig	252..343	CDD:299845	26/92 (28%)
		IG_like	261..343	CDD:214653	24/81 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900