Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
Alignment Length: | 254 | Identity: | 67/254 - (26%) |
---|---|---|---|
Similarity: | 103/254 - (40%) | Gaps: | 60/254 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 WTLVLYLFSFSLSLIGG------------------------SFILPENDPPTTA---PKFL---- 42
Fly 43 --SRGHLYKVIVGETIELPCKVQNLGSFVLLW--RKGSSVLTAGHLKITRDQRFKI-----VGDY 98
Fly 99 NLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVP-PTLRALPHNGQVTARKGSTVTLECKASG 162
Fly 163 NPVPT--IFWF----------KKDVFSGPTHLSDSST--LILENVDRHHAGTYQCSADN 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 27/89 (30%) |
Ig | 56..116 | CDD:143165 | 22/66 (33%) | ||
IG_like | 144..221 | CDD:214653 | 22/78 (28%) | ||
IGc2 | 151..209 | CDD:197706 | 21/71 (30%) | ||
IG_like | 232..313 | CDD:214653 | |||
Ig | 242..311 | CDD:143165 | |||
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 27/94 (29%) |
IG_like | 80..175 | CDD:214653 | 27/94 (29%) | ||
IG_like | 184..271 | CDD:214653 | 23/81 (28%) | ||
IGc2 | 191..262 | CDD:197706 | 21/71 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12424 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |