DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr6

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:254 Identity:67/254 - (26%)
Similarity:103/254 - (40%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WTLVLYLFSFSLSLIGG------------------------SFILPENDPPTTA---PKFL---- 42
            |.|:|.:...|....||                        :.:||  ..||.|   ||::    
  Fly    13 WLLLLVVIVMSDMTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLP--TAPTAAYTHPKWMEPYF 75

  Fly    43 --SRGHLYKVIVGETIELPCKVQNLGSFVLLW--RKGSSVLTAGHLKITRDQRFKI-----VGDY 98
              |.......::|::..|.|:|:||.:..:.|  .:...:||.|....|.||||:.     ..|:
  Fly    76 DPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDW 140

  Fly    99 NLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVP-PTLRALPHNGQVTARKGSTVTLECKASG 162
            .|||...:.:|||.|.||:..|..|.....:.::|| .|:...|   .:...||||:.|.|....
  Fly   141 TLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGP---DLHVDKGSTINLTCTVKF 202

  Fly   163 NPVPT--IFWF----------KKDVFSGPTHLSDSST--LILENVDRHHAGTYQCSADN 207
            :|.|.  |||:          .:...|..|...|.:|  |:::|.|...:|.|.|:..|
  Fly   203 SPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 27/89 (30%)
Ig 56..116 CDD:143165 22/66 (33%)
IG_like 144..221 CDD:214653 22/78 (28%)
IGc2 151..209 CDD:197706 21/71 (30%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
dpr6NP_001287018.1 V-set 79..174 CDD:284989 27/94 (29%)
IG_like 80..175 CDD:214653 27/94 (29%)
IG_like 184..271 CDD:214653 23/81 (28%)
IGc2 191..262 CDD:197706 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.