DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and tutl

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:529 Identity:115/529 - (21%)
Similarity:189/529 - (35%) Gaps:135/529 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGSFILPENDPPTTAPKFLSRGHLYKVIVGETIELPCKVQNL-GSFVLLW-RKGSSVLTAGHL 84
            :.||:.|:.   |||...|          :.||.:...|:.:.: |:..:.| |:||.|.....|
  Fly   341 IAGGAVIMV---PPTNQTK----------LEGEKVIFSCEAKAMPGNVTVRWYREGSPVREVAAL 392

  Fly    85 KITRDQRFKIVGDYNLQINGVKTQDAGDYICQ----LGDQENRDQVHTVE----ILVPPTLRALP 141
                :.|..|..|.:|.||.:|..|:|.|:|:    :||.::.....:||    :...||::.||
  Fly   393 ----ETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSVEYPAKVTFTPTVQYLP 453

  Fly   142 HNGQVTARKGSTVTLECKASGNP-VPTIFWFKKDVFSGPTHLSD-----SSTLILENVDRHHAGT 200
            .      |....|  :|....:| :..:.|.|......|..:.|     :.:|:...|:..|.|.
  Fly   454 F------RLAGVV--QCYIKSSPQLQYVTWTKDKRLLEPYQMKDIVVMANGSLLFTRVNEEHQGQ 510

  Fly   201 YQCSADN--------GVKDRVSMDIQLTILSPPEITVEKSWVHASE-GYDVELVC---IVHGDVN 253
            |.|:..|        ||.|       :.:..||..|||...::..: |..||:.|   ...|...
  Fly   511 YACTPYNAQGTAGASGVMD-------VLVRKPPAFTVEPETLYQRKVGDSVEMHCDALEAEGTER 568

  Fly   254 SEMLWY-QNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGR----TKKYIEVS 313
            ..:.|. |....|..:.|..:  :....::.|.|.:..|||.|.||..|.:..    |:..||.:
  Fly   569 PTIKWQRQEGEQLTESQRNRI--KISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQLVIEGT 631

  Fly   314 GRPGPADFIS------------PALSG---FLDHYNL--------TWTIESIPPLDEIKLLYRRL 355
            ....|.:...            |..||   :...|.:        .|...|:.|....::....|
  Fly   632 QPHAPYNITGKATESSITLQWLPGYSGGSEYKQDYTIWFREAGVNDWQTISVTPSGSTQVTINGL 696

  Fly   356 LMNETYQHPGKWHEYHIKPTPIRTDGSHFLMSYL--VKNLEHNAVYEAIVQAKN-KYGWNEISDI 417
            ....||       |:.:....:..||   :||.:  |:.||     :|....:| |.........
  Fly   697 ASGTTY-------EFQVVGRNVLGDG---MMSKVMTVRTLE-----DAPAAPRNVKAATQPPDSF 746

  Fly   418 HQFYTRNHDLLLDIDMEY--------------------KMGISSNIRISPTVSGIILS------- 455
            .|......|||...|:.:                    |.|...|:.::...:|.:::       
  Fly   747 FQLMPDEADLLAYFDIYFHTDSRGTLVYSPPKLRVKGPKPGPPRNVSVTEVSNGFLITWQSPLER 811

  Fly   456 AFILVLYPI 464
            |.|:..|.|
  Fly   812 AHIVKFYTI 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 25/92 (27%)
Ig 56..116 CDD:143165 18/61 (30%)
IG_like 144..221 CDD:214653 18/90 (20%)
IGc2 151..209 CDD:197706 14/71 (20%)
IG_like 232..313 CDD:214653 21/89 (24%)
Ig 242..311 CDD:143165 18/76 (24%)
tutlNP_001303307.1 V-set 137..250 CDD:284989
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 115/529 (22%)
IGc2 268..331 CDD:197706
I-set 346..437 CDD:254352 28/107 (26%)
Ig 349..437 CDD:299845 27/104 (26%)
Ig 459..530 CDD:299845 17/79 (22%)
IG_like 549..628 CDD:214653 19/80 (24%)
IGc2 551..617 CDD:197706 18/67 (27%)
FN3 633..725 CDD:238020 17/101 (17%)
FN3 786..874 CDD:238020 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.