DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr17

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:208 Identity:52/208 - (25%)
Similarity:85/208 - (40%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VGETIELPCKVQNLGSFVLLW--RKGSSVLTAGHLKITRDQRFKIV----GDY--NLQINGVKTQ 108
            :|....:||::..|....:.|  .:.:.:::........|:||:.:    .||  :|||..|:..
  Fly   419 MGNHAYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPS 483

  Fly   109 DAGDYICQLGDQENRD-QVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASG--NPVPTIFW 170
            |||.|.||:..:.... :|| ::|:.|.|  .|..:.....:.||.|.|.|...|  :|...|.|
  Fly   484 DAGWYECQMATEPKLSAKVH-LQIV
KPKT--ELIGDQSRFVKAGSKVALHCIVRGTLDPPKYIIW 545

  Fly   171 FKKDVFSGPTHLSDS-------------------------STLILENVDRHHAGTYQCSADNGVK 210
            |:     |...:|||                         .:||:..|.:..:|.|.|...|.  
  Fly   546 FR-----GQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTCQPSNS-- 603

  Fly   211 DRVSMDIQLTILS 223
              ||:.:.|.:||
  Fly   604 --VSVSVDLHVLS 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/89 (26%)
Ig 56..116 CDD:143165 17/67 (25%)
IG_like 144..221 CDD:214653 24/103 (23%)
IGc2 151..209 CDD:197706 21/84 (25%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 18/71 (25%)
Ig 415..507 CDD:299845 22/88 (25%)
IG_like 521..612 CDD:214653 24/99 (24%)
IGc2 524..605 CDD:197706 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.