DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and MAG

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_002352.1 Gene:MAG / 4099 HGNCID:6783 Length:626 Species:Homo sapiens


Alignment Length:440 Identity:97/440 - (22%)
Similarity:161/440 - (36%) Gaps:103/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILPENDPPTTAPKFLSRGHL-----Y--------------------KVIVGETIELPCKV----- 62
            :|..|..|....|:..||.|     |                    :|:.|..:|:.|.|     
Human   102 LLLSNVSPELGGKYYFRGDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCP 166

  Fly    63 -----------QNLGSFVLLWR----KGSSV-LTAGHLKITRDQRFKIVG------DYNLQINGV 105
                       :.||...:|.|    :|:.| ::..|...||:.....:|      :..||..|.
Human   167 ELRPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTREANGHRLGCQASFPNTTLQFEGY 231

  Fly   106 KTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFW 170
            .:.|                     :..||.:  :..|..|.|.:||.|:|.|.|..||.|.:.|
Human   232 ASMD---------------------VKYPPVI--VEMNSSVEAIEGSHVSLLCGADSNPPPLLTW 273

  Fly   171 FKKDVFSGPTHLSDSSTLILENVDRHHAGTYQCSADN--GVKDRVSMDIQLTIL-SPPEITVEKS 232
            .:........ :::|..|.||.|.....|.|.|.|:|  |..:|.   :.|::: :|.:.||..:
Human   274 MRDGTVLREA-VAESLLLELEEVTPAEDGVYACLAENAYGQDNRT---VGLSVMYAPWKPTVNGT 334

  Fly   233 WVHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSC 297
            .| |.||..|.::|....:.:..:..::...:|...    :|  :....|.:....|.|.|.|.|
Human   335 MV-AVEGETVSILCSTQSNPDPILTIFKEKQILSTV----IY--ESELQLELPAVSPEDDGEYWC 392

  Fly   298 VADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIESIP-PLDEIKLLYRRLLMNETY 361
            ||:|..|:......:|....|...:....:...|.......::|.| |....:|..|.:.:||:.
Human   393 VAENQYGQRATAFNLSVEFAPVLLLESHCAAARDTVQCLCVVKSNPEPSVAFELPSRNVTVNESE 457

  Fly   362 QHPGKWHEYHIKPTPIRTDGSHF-LMSYLVKNLEHNAVYEAIVQAKNKYG 410
            :      |:      :.::.|.. |.|.|....:..|....|..|:|.||
Human   458 R------EF------VYSERSGLVLTSILTLRGQAQAPPRVICTARNLYG 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 19/109 (17%)
Ig 56..116 CDD:143165 17/86 (20%)
IG_like 144..221 CDD:214653 25/78 (32%)
IGc2 151..209 CDD:197706 20/59 (34%)
IG_like 232..313 CDD:214653 18/80 (23%)
Ig 242..311 CDD:143165 14/68 (21%)
MAGNP_002352.1 Interaction with RTN4R and RTN4RL2. /evidence=ECO:0000250|UniProtKB:P07722 20..325 55/249 (22%)
Ig_Siglec_N 22..139 CDD:143189 8/36 (22%)
Ganglioside GT1b binding. /evidence=ECO:0000250|UniProtKB:P20917 65..67
Ganglioside GT1b binding. /evidence=ECO:0000250|UniProtKB:P20917 124..128 0/3 (0%)
Ig 141..223 CDD:325142 15/81 (19%)
Ig_3 239..309 CDD:316449 24/72 (33%)
IG_like 333..409 CDD:214653 18/82 (22%)
Required for normal axon myelination in the central nervous system. /evidence=ECO:0000250|UniProtKB:P20917 577..626
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 582..608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.