Sequence 1: | NP_001262181.1 | Gene: | CG7166 / 40401 | FlyBaseID: | FBgn0037107 | Length: | 467 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
Alignment Length: | 199 | Identity: | 52/199 - (26%) |
---|---|---|---|
Similarity: | 79/199 - (39%) | Gaps: | 42/199 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 VGETIELPCKVQNLGSFVLLW---RKGSSVLTAGHLKITRDQRFKIVGD----YNLQINGVKTQD 109
Fly 110 AGDYICQLGDQENRDQVHTVEILVPPT-LRALPHNGQVTARKGSTVTLECKASG--NPVPTIFWF 171
Fly 172 KKDVFSGPTHLSDSS-----------------------TLILENVDRHHAGTYQCSADNGVKDRV 213
Fly 214 SMDI 217 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7166 | NP_001262181.1 | IG_like | 50..133 | CDD:214653 | 26/87 (30%) |
Ig | 56..116 | CDD:143165 | 23/66 (35%) | ||
IG_like | 144..221 | CDD:214653 | 22/99 (22%) | ||
IGc2 | 151..209 | CDD:197706 | 20/82 (24%) | ||
IG_like | 232..313 | CDD:214653 | |||
Ig | 242..311 | CDD:143165 | |||
dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 26/85 (31%) |
Ig | 127..217 | CDD:299845 | 26/86 (30%) | ||
IG_like | 227..320 | CDD:214653 | 22/100 (22%) | ||
IGc2 | 234..311 | CDD:197706 | 19/81 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 42 | 1.000 | Domainoid score | I12424 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |