DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr16

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:344 Identity:70/344 - (20%)
Similarity:106/344 - (30%) Gaps:108/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PENDPPTTAPKFLSRGHLY----------------------------------KVIVGETIELPC 60
            |...|..:.|...||.|.|                                  .|..|:...|||
  Fly   156 PSGSPMPSKPNEQSRLHAYDSEQKAQQLRREKELAKERELLPRRQLSLPPLNATVQAGQHAYLPC 220

  Fly    61 KVQNLGSFVLLW--RKGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQLGDQENR 123
            |:.......|.|  .:...::...|.....|.||                               
  Fly   221 KLNQHSGKPLSWVRLRDEHIIAVDHTTFINDARF------------------------------- 254

  Fly   124 DQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHLSDSS-- 186
                 ..:|...||..|...|.:     ||......|.||.      |...|..|....:.||  
  Fly   255 -----ASLLQSTTLTTLVSGGAL-----STTATPVAALGNS------FAHAVPGGQERGNSSSLS 303

  Fly   187 -TLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHG 250
             ||.::.|:...||.|:|..  ..:.::|..:||.:::|....:.........|..|||.|||.|
  Fly   304 WTLQIKYVNLEDAGWYECQL--ATEPKMSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRG 366

  Fly   251 DVNSE--MLWYQNSFLLDATDRRS-----MYPRDDRY-------------SLIIRNFQPTDFGNY 295
            .:.:.  :.||:....:.|.:..|     .|.:.||.             ||:|...:....|||
  Fly   367 TLEAPKYIFWYRGDQQVTAENEASGAQSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNY 431

  Fly   296 SCVADNALGRTKKYIEVSG 314
            :|..:|:...:.:...:||
  Fly   432 TCEPENSAAASMQLHVLSG 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 12/84 (14%)
Ig 56..116 CDD:143165 10/61 (16%)
IG_like 144..221 CDD:214653 21/79 (27%)
IGc2 151..209 CDD:197706 17/60 (28%)
IG_like 232..313 CDD:214653 23/100 (23%)
Ig 242..311 CDD:143165 22/88 (25%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 37/180 (21%)
Ig <298..338 CDD:299845 12/41 (29%)
IG_like 352..447 CDD:214653 23/94 (24%)
Ig 358..439 CDD:143165 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.