DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and LSAMP

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:268 Identity:79/268 - (29%)
Similarity:123/268 - (45%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVG----DYNLQINGVKTQDAGDY 113
            |:|..|.|.|::..|.| .|...|.::.|||.|.:.|.|.::..    :|:|:|..|...|.|.|
Human    46 GDTAILRCVVEDKNSKV-AWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSY 109

  Fly   114 ICQLGDQE--NRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGNPVPTIFWFKKDVF 176
            .|.:..|.  ...||:.: :.|||.:..:  :..||..:||.|||.|.|:|.|.|.|.|      
Human   110 TCSVQTQHEPKTSQVYLI-V
QVPPKISNI--SSDVTVNEGSNVTLVCMANGRPEPVITW------ 165

  Fly   177 SGPTHLS--------DSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPPEITVEKSW 233
               .||:        :...|.:..:.|..:|.|:|.|.|.|.......:::|:..||.||..|| 
Human   166 ---RHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTV
NYPPTITESKS- 226

  Fly   234 VHASEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCV 298
            ..|:.|....|.|........:..||::...:::.:...:...:.:.||.:.|.....:|||:||
Human   227 NEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCV 291

  Fly   299 ADNALGRT 306
            |.|.||.|
Human   292 AANKLGVT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 26/85 (31%)
Ig 56..116 CDD:143165 20/63 (32%)
IG_like 144..221 CDD:214653 24/84 (29%)
IGc2 151..209 CDD:197706 21/65 (32%)
IG_like 232..313 CDD:214653 20/75 (27%)
Ig 242..311 CDD:143165 17/65 (26%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 26/83 (31%)
Ig 132..215 CDD:386229 25/93 (27%)
Ig_3 219..294 CDD:372822 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.