DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr10

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:260 Identity:65/260 - (25%)
Similarity:96/260 - (36%) Gaps:90/260 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PENDPPTTAPKFLSRGHLYK-------------VIVGETIELPCKVQNLGSFVLLW--RKGSSVL 79
            |.:.||:..|    .||.:.             .:||::..|.|:|::||:..:.|  .:...:|
  Fly    36 PTHAPPSHYP----HGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHIL 96

  Fly    80 TAGHLKITRDQRFKI-----VGDYNLQINGVKTQDAGDYICQLGDQ------------------- 120
            |.|....|.||||:.     :.::.|||...:.:|||.|.||:..|                   
  Fly    97 TVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVYECQISTQPVRSYSVNLNIVDLIDAET 161

  Fly   121 ----------------ENR------DQ-------VHTVEILVPPTLRALPHNGQVTARKGSTVTL 156
                            |||      |:       :.||.:   ||...| ....:...||||:.|
  Fly   162 SDIMQQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAV---PTATIL-GGPDLYVDKGSTINL 222

  Fly   157 EC--KASGNPVPTIFWFKKD-VFSGPT-----------HLSDSSTLILENVDRHHAGTYQCSADN 207
            .|  |.|..|...|||:.:| |.|..|           .....|.|::.:.|..|:|.|.|...|
  Fly   223 TCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLHSGKYSCYPSN 287

  Fly   208  207
              Fly   288  287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 32/137 (23%)
Ig 56..116 CDD:143165 21/66 (32%)
IG_like 144..221 CDD:214653 24/78 (31%)
IGc2 151..209 CDD:197706 23/71 (32%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
dpr10NP_729591.1 Ig 63..143 CDD:299845 25/79 (32%)
IG_like 210..297 CDD:214653 24/78 (31%)
IGc2 217..287 CDD:197706 22/69 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.