DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and dpr13

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:187 Identity:55/187 - (29%)
Similarity:80/187 - (42%) Gaps:45/187 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VGETIELPCKVQNLGSFVLLW--RKGSSVLTAGHLKITRDQRF-----KIVGDYNLQINGVKTQD 109
            :|.|..:||.|.::|..|:.|  :|...:||.|....:.|:||     |...|:.|||..|:.:|
  Fly   189 IGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRD 253

  Fly   110 AGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTAR------------KGSTVTLECKASG 162
            ||.|.||:...             |||...| |...|.||            .|||:.|:|:...
  Fly   254 AGVYECQVSTH-------------PPTSIFL-HLSVV
EARAEITGPPIRYLTPGSTLRLQCRVVQ 304

  Fly   163 NPVPT--IFWF------KKDVFSGPTHLSD----SSTLILENVDRHHAGTYQCSADN 207
            |...:  |||:      ..|:..|....::    ||.|.::...|.|:|.:.|.|.|
  Fly   305 NTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 27/87 (31%)
Ig 56..116 CDD:143165 23/66 (35%)
IG_like 144..221 CDD:214653 23/88 (26%)
IGc2 151..209 CDD:197706 20/69 (29%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
dpr13NP_001033956.2 V-set 180..276 CDD:284989 32/100 (32%)
IG_like 182..262 CDD:214653 27/72 (38%)
IG_like 285..362 CDD:214653 20/77 (26%)
IGc2 292..361 CDD:197706 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.