DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Dscam2

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:469 Identity:109/469 - (23%)
Similarity:181/469 - (38%) Gaps:84/469 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PPTTAPKFLSRGHLYKVIVGETIELPCKVQNLGSFVLL--WRK-GSSVLTAGHLKITRDQRFKIV 95
            ||..:|   .:.::.::.:|:...|.|.|.. |...|.  ||| |..:....|:.:      |.|
  Fly   611 PPKLSP---FQTNILQLNMGDRASLTCSVVK-GDLPLTINWRKDGRPIDPTQHMSV------KQV 665

  Fly    96 GDYN--LQINGVKTQDAGDYICQLGDQENRDQVHTVE------ILVPPTLRALPHNGQVTARKGS 152
            ..||  |.|..:.:...|:|.|.:     |:....||      :.|||.....|.:..|  .:..
  Fly   666 DQYNSILVIENLGSDHTGNYSCVV-----RNSAAEVENSQALLVNVPPRWIVEPVDANV--ERNR 723

  Fly   153 TVTLECKASGNPVPTIFWFK---------KDVFSGP-THLSDSSTLILENVDRHHAGTYQCSADN 207
            .:.|.|:|.|.|.|:|.|.|         ::|...| |.|..:.:|:|::|.....|.|.|.|:|
  Fly   724 HIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANN 788

  Fly   208 GVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLW-------------Y 259
            |:...:...|||.:.|.|..:.....|...:|....|.|.|.||....::|             |
  Fly   789 GIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNY 853

  Fly   260 QNSFLLDATDRRSMYPRDDRYSLIIRNFQPTDFGNYSCVADNALGRTKKYI--EVSGRPGPADFI 322
            :.|...:||      |......|.||....||.|.|.|.|.|..|..::.:  :|...|.|...:
  Fly   854 KISVKQEAT------PDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVL 912

  Fly   323 SPALSGFLDHYNLTWTIESIPPLDEIKLLYRRLLMNETYQHP-----GKWHEYHIKPTPIRTDGS 382
            ..|:..... .|:.|..:::...|..|.:..  .....:..|     .:|.:..:|..|      
  Fly   913 EAAMISSRS-VNIKWQPKTLGTGDVTKYIVE--FREADHSLPPALFVDQWQQIEVKDPP------ 968

  Fly   383 HFLMSYLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISP 447
            ||  :.:::||:....|...|.|:...|.:..|         .:|::..:.:...|...::...|
  Fly   969 HF--NAMIENLKPATRYAFRVIAEGSAGRSAPS---------QELIVRTEPQRPAGPPLSLSARP 1022

  Fly   448 TVSGIILSAFILVL 461
            ..|..:|.:::..|
  Fly  1023 LSSTELLISWVAPL 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 23/93 (25%)
Ig 56..116 CDD:143165 18/64 (28%)
IG_like 144..221 CDD:214653 26/86 (30%)
IGc2 151..209 CDD:197706 21/67 (31%)
IG_like 232..313 CDD:214653 24/95 (25%)
Ig 242..311 CDD:143165 22/83 (27%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653
IGc2 436..507 CDD:197706
I-set 521..610 CDD:254352
IGc2 533..597 CDD:197706
Ig 630..699 CDD:143165 22/80 (28%)
IG_like 714..802 CDD:214653 27/89 (30%)
Ig 725..802 CDD:299845 25/76 (33%)
Ig 823..894 CDD:143165 22/76 (29%)
FN3 906..1006 CDD:238020 21/119 (18%)
FN3 1013..1111 CDD:238020 5/24 (21%)
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.