DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and CG13506

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:449 Identity:111/449 - (24%)
Similarity:189/449 - (42%) Gaps:75/449 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GETIELPCKVQNLG-SFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQ 116
            |:.:.|.|..:|.. |..::|.|...::..|...|:  ||.:.:.:.::.:..|..:|:.||.|:
  Fly    84 GDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPIS--QRVQCMLNNSILLRNVSPEDSDDYYCE 146

  Fly   117 LGDQENRDQVHTVEILVPPTLRALPHNGQV-----TARKGSTVTLECKASGNPVPTIFWFKKDVF 176
            :..|..|.  ||. :.|...|..|..:..:     |.|:|....|||:.......||.|...|:.
  Fly   147 ILPQRVRQ--HTA-LRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLN 208

  Fly   177 SGPTHL-SDSSTLILENVDRHHAGTYQCSADNGVK----DRVSMDIQLTILSPPEITVEKSWVHA 236
            ..|:.: :.:..:||:|||..:||.|||.||:|.:    ..|.:|:|.:    |.::..:..|:.
  Fly   209 GQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYS----PIVSTHRHNVNT 269

  Fly   237 SEGYDVELVCIVHGDVNSEMLWYQNSFLLDATDRRSM----YPRDDRYSLIIRNFQPTDFGNYSC 297
            .:|...||.|...........:.::...|..:|:.|:    :...:|.:||:|....:|.|.|.|
  Fly   270 EKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLC 334

  Fly   298 VADNALGRTKKYIEVSGRPGPADFISPALSGFLDHYNLTWTIESIPPLDEIKLLYR--------R 354
            ..:||:|..:..:.||..|....|....:.|  :...|.|.:.|...|.|..|.|:        .
  Fly   335 QVENAIGSNEVKVHVSYNPETPQFEDMTVEG--NKVTLHWLVRSHQLLSEAMLDYQLTGSYTWST 397

  Fly   355 LLMNETYQHPGK---WHEYHIKPTPIRTDGSHFLMSYLVKNLE-HNAVYEAIVQAKNKYGWNEIS 415
            :.:.||::|...   |...|                    .|| ...|:.|.|:.||..||:..|
  Fly   398 VQVLETHRHNNTDNIWKITH--------------------QLELSRGVWHARVKTKNTKGWSHFS 442

  Fly   416 DIHQF-------YTRNHDLLLDIDMEYKMGI--------SSNIRISPTVSGIILSAFIL 459
            :.|.|       ..::.::.|..|...:.||        ||..|::  |..|:|:|.:|
  Fly   443 NDHVFEIPEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQRLN--VGVILLAALLL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 20/80 (25%)
Ig 56..116 CDD:143165 14/60 (23%)
IG_like 144..221 CDD:214653 27/86 (31%)
IGc2 151..209 CDD:197706 21/58 (36%)
IG_like 232..313 CDD:214653 19/84 (23%)
Ig 242..311 CDD:143165 17/72 (24%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 15/63 (24%)
IGc2 83..146 CDD:197706 15/63 (24%)
IG_like 176..254 CDD:214653 25/77 (32%)
Ig 176..239 CDD:299845 21/62 (34%)
I-set 258..349 CDD:254352 20/90 (22%)
Ig 275..348 CDD:143165 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45080
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.