DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Strn-Mlck

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster


Alignment Length:491 Identity:117/491 - (23%)
Similarity:172/491 - (35%) Gaps:173/491 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TYTRKYWTLVLYLFSFSLSLIGGSFILPENDPP---TTAPKFLSRG--HL--------------- 47
            |.|:..|.|.|..:|.:      |:.   .|||   :|.|..:..|  |:               
  Fly  6195 TPTQPRWGLPLDSYSDT------SYF---RDPPGCISTEPLVVDSGPTHISLSWGKPVSANSAPV 6250

  Fly    48 --YKV---IVGETIELPCKVQNLGSFVLLWRK-GSSVLTA-----------GHLKITRDQRF--- 92
              |||   :||         ...|::   ||: |.:.:.:           .|.::|...|:   
  Fly  6251 MAYKVEAWVVG---------HEGGAY---WRELGLTPINSFDAFNLKPNVEYHFRVTPKNRYGWG 6303

  Fly    93 -KIVGDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTL 156
             .:.....||:.||:        |                 :|..::.||  ||..|..||:.||
  Fly  6304 PTVQTSSPLQVGGVE--------C-----------------LPEFVKILP--GQAKALLGSSFTL 6341

  Fly   157 ECKASGNPVPTIFWFKKDVFSGPTHLSDSS------------TLILENVDRHHAGTYQCSADNGV 209
            :|...|.|.|.:.|||..:     .||.||            .|.:..|....:|.|.|.|.|. 
  Fly  6342 QCNMRGAPRPQVTWFKDGI-----QLSSSSERVKIRQIGSTCALTIATVSELDSGRYTCEATNS- 6400

  Fly   210 KDRVSMDIQLTILSPPEI----TVEKSWVH----ASEG------------------YDVELVCIV 248
            |.|||...:|.::|...|    :..|...|    |..|                  |.|.|.|.:
  Fly  6401 KGRVSTFARLQVVSDSRIYEADSRLKEIAHGRNVADVGDSLPIFTMRLRDRRVQVTYPVRLTCQI 6465

  Fly   249 HGDVNSEMLWYQNSFLLDATDRRSMYPRDDR-YSLIIRNFQPTDFGNYSCVADNALGRTKKYIEV 312
            .|....|:|||::..|:. |||:.:...:.: ::|.|......|.|.|:|:|.|.||....:..:
  Fly  6466 VGYPVPEILWYKDDELIH-TDRKHLISAEGQFFTLEIAATTLDDSGTYTCLARNELGSVSCHCTL 6529

  Fly   313 SGRPGPADFISPALSGFLDHYNLTWTIESIPPLD---------EIKLLYRRLLMNETYQHPG-KW 367
            ....|...:|||      |.|         .|||         ||:|..:    .|.|...| .|
  Fly  6530 VVDKGIRAYISP------DFY---------VPLDPFYIFREGSEIRLSTK----VEAYPSVGVTW 6575

  Fly   368 HEYHIKPTPIRTDGSHFLMSYLVKNLEHNAVYEAIV 403
            |...::..|.|.         |...|:.|...|.|:
  Fly  6576 HRNGMRLRPSRR---------LTATLDSNGYVELII 6602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 15/101 (15%)
Ig 56..116 CDD:143165 11/75 (15%)
IG_like 144..221 CDD:214653 30/88 (34%)
IGc2 151..209 CDD:197706 22/69 (32%)
IG_like 232..313 CDD:214653 26/103 (25%)
Ig 242..311 CDD:143165 22/69 (32%)
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020 19/105 (18%)
I-set 6321..6412 CDD:254352 33/98 (34%)
Ig 6328..6412 CDD:299845 31/91 (34%)
I-set 6442..6531 CDD:254352 23/89 (26%)
Ig 6459..6528 CDD:143165 22/69 (32%)
I-set 6541..6632 CDD:254352 21/90 (23%)
IGc2 6555..6622 CDD:197706 15/61 (25%)
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.