DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and Dscam1

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:462 Identity:100/462 - (21%)
Similarity:160/462 - (34%) Gaps:135/462 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VGETIELPCKVQNLGSFVLLWRKGSSVLTAGHLKITRDQRFKIVGDYNLQINGVKTQDAGDYICQ 116
            :|::|:|.|::|.                               ||..::::....:.||||   
  Fly   635 MGDSIDLFCQIQK-------------------------------GDRPIKVHWSFERSAGDY--- 665

  Fly   117 LGDQENRDQVHTVEILVPPTLRALP-----HNGQVTA---------------------------- 148
             |..:.:.|:.|..|....::.::|     |.|:.|.                            
  Fly   666 -GFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNVPPRWILEPT 729

  Fly   149 ----RKGSTVTLECKASGNPVPTIFWFKKDVFSGPTHLSD----------SSTLILENVDRHHAG 199
                .:||...:||||.|.|.|.:.| ||.|...|....|          ..||.::|:.:.:.|
  Fly   730 DKAFAQGSDAKVECKADGFPKPQVTW-KKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEG 793

  Fly   200 TYQCSADNGVKDRVSMDIQLTILSPPEITVEKSWVHASEGYDVELVCIVHGDVNSEMLWYQNSFL 264
            .|.|.|.||:...:|..|.:::.:|||.|.:.....|..|....|.|...|:....:||..|:..
  Fly   794 YYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMR 858

  Fly   265 LDATDRRSMYPRDDRY-------------SLIIRNFQPTDFGNYSCVADNALGRTKKYIEVSGRP 316
            ||..:       |:||             ||.|:..:.:|...::|||.||.|.....|.:..:.
  Fly   859 LDPKN-------DNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQE 916

  Fly   317 GPADFISPALSGFLD----HYNLTWT--IESIPPLDEIKLLYRRLLMNETYQHPGKWHEYHIKPT 375
            .|.   .|.....||    ...|:|.  .:...|||...:.::|        ....|.|......
  Fly   917 VPE---MPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKR--------SRASWSEIDRVIV 970

  Fly   376 PIRTDGSHFLMSYLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTRNHDLLLDIDMEYKMGIS 440
            |..|..:.      |:.|.....|...:.|:|..|.::.|:.....|..         |...|..
  Fly   971 PGHTTEAQ------VQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAE---------EAPSGKP 1020

  Fly   441 SNIRISP 447
            .||::.|
  Fly  1021 QNIKVEP 1027

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 15/80 (19%)
Ig 56..116 CDD:143165 10/59 (17%)
IG_like 144..221 CDD:214653 28/118 (24%)
IGc2 151..209 CDD:197706 23/67 (34%)
IG_like 232..313 CDD:214653 24/93 (26%)
Ig 242..311 CDD:143165 21/81 (26%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165 17/107 (16%)
IGc2 735..804 CDD:197706 24/69 (35%)
I-set 819..914 CDD:254352 27/101 (27%)
Ig 833..921 CDD:299845 24/97 (25%)
FN3 918..1011 CDD:238020 21/109 (19%)
FN3 1018..1116 CDD:238020 4/10 (40%)
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.