DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7166 and bdl

DIOPT Version :9

Sequence 1:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:630 Identity:123/630 - (19%)
Similarity:208/630 - (33%) Gaps:238/630 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LIGGSFILPENDP--------------------------PTTAPKFLSRGHLYKVIV--GETIEL 58
            |..|...|.||.|                          |..:|...:.|..|.:.|  |..|.:
  Fly    91 LFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHCQVSFPNRSPSVRNNGTAYHLAVQGGSLIRI 155

  Fly    59 P---------------CKVQNLGSFVLLWRKGSSVLTAGHLKITRD--QRFKIVGDYNLQINGVK 106
            |               |.:::..:....|.| ..||    |:..:|  :||.:..|.:|.|:...
  Fly   156 PPVNQTIREGQTAFFHCVMKHPENSQASWYK-DGVL----LQEVQDLVRRFYMGPDGSLSIDPTM 215

  Fly   107 TQDAGDYICQLGDQENRDQV--------HTVEILVPPTLRALPHNGQVTARKGSTVTLECKASGN 163
            ..|.|:|.|::.:.:...|.        :..:::..|....||:        |....|:|....|
  Fly   216 MSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPY--------GQPAVLDCHFRAN 272

  Fly   164 -PVPTIFWFKK----DVFSGP-THLSDSSTLILENVDRHHAGTYQCSADNGV-KDRVSMDIQLTI 221
             |:..:.|.|.    |.::.| .....:.:|....||.:|||:|.|:..|.: .|..|..|.:.:
  Fly   273 PPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIV 337

  Fly   222 LSPPEITVEKSWVHASE-GYDVELVC-IVHGDVNS--EMLWYQNSFLLDATDRRSMYPRD-DRYS 281
            |.||..:|....::..: |...||.| .:..|.|:  .::|          .|:...|.. ||:|
  Fly   338 LRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIW----------GRKDGQPLPADRFS 392

  Fly   282 LIIRNFQPT-----DFGNYSCVADN------------------------ALGRTKKYIEVSGRPG 317
            |...|...|     |.|.|.|.|.|                        ....|:..|.:..:||
  Fly   393 LSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTETCITIRWQPG 457

  Fly   318 PADFISPALSGFLDHYNLTWTIESIPPLDEIKLLYRRLLMNETYQH--PGKWHEYHI-------- 372
               ::.|.|     .|.:.:.:...|....:::|.:: :|..|.||  |||.:|:.:        
  Fly   458 ---YLRPNL-----EYTVWYRLMEAPEWRTLRVLDKK-VMEATVQHLQPGKEYEFMVLSQDKYGD 513

  Fly   373 -----------KPTPIRTDG--------------------------------------------- 381
                       .|:|||.|.                                             
  Fly   514 GMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGLGAPWNLTAISNQQGWLLHWEHPVQG 578

  Fly   382 ---------------SHFLMS--------YLVKNLEHNAVYEAIVQAKNKYGWNEISDIHQFYTR 423
                           .|||:.        |.:::|:.:.:::..|.|        :....|....
  Fly   579 LEGLRLYAVRWWKEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVLA--------VGTETQQSVP 635

  Fly   424 NHDLLLDIDMEYKMG---ISSNIRISPTVSGII-----LSAFILV 460
            :|:||:|:..:.|:.   |.|::       |:|     |.||:.|
  Fly   636 SHELLIDVPSQRKVRALIIGSSV-------GVIFLLCALCAFLYV 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 21/109 (19%)
Ig 56..116 CDD:143165 17/76 (22%)
IG_like 144..221 CDD:214653 21/83 (25%)
IGc2 151..209 CDD:197706 18/63 (29%)
IG_like 232..313 CDD:214653 23/114 (20%)
Ig 242..311 CDD:143165 21/101 (21%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 6/36 (17%)
Ig 43..131 CDD:299845 6/39 (15%)
I-set 153..242 CDD:254352 19/93 (20%)
Ig 157..242 CDD:299845 17/89 (19%)
Ig_2 252..337 CDD:290606 24/92 (26%)
IG_like 260..327 CDD:214653 18/66 (27%)
I-set 341..428 CDD:254352 23/96 (24%)
IGc2 356..419 CDD:197706 21/72 (29%)
FN3 435..524 CDD:238020 17/97 (18%)
FN3 554..636 CDD:238020 8/89 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.